SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g11670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g11670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g11670

Feature Type:gene_model
Chromosome:Gm12
Start:9752697
stop:9755545
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g11670
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21450AT Annotation by Michelle Graham. TAIR10: PapD-like superfamily protein | chr4:11426136-11428125 FORWARD LENGTH=295 SoyBaseE_val: 1.00E-98ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
KOG0439 KOG VAMP-associated protein involved in inositol metabolism JGI ISS
PTHR10809Panther VESICLE-ASSOCIATED MEMBRANE PROTEIN (VAMP) JGI ISS
PF00635PFAM MSP (Major sperm protein) domain JGI ISS
UniRef100_D7MET3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MET3_ARALL SoyBaseE_val: 3.00E-98ISS
UniRef100_UPI000233CA54UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CA54 related cluster n=1 Tax=unknown RepID=UPI000233CA54 SoyBaseE_val: 7.00E-128ISS

Expression Patterns of Glyma12g11670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g11670 not represented in the dataset
Glyma12g11670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g11670 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g106800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g11670
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g11670
>Glyma12g11670.2   sequence type=CDS   gene model=Glyma12g11670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCATTTTGGCAAACAACTCATGCTTCTTCAACTTCTTCAACAACAACTTTTTCTATGCATCATAGCGTTCACCATCAGAGCCAGATTCTTCAGTCTCTTGATAGATCCACCCATCAACCTTCCACCACTGTTTCTTCTGTGGCCAAGTCTCTTCTGCCCACAAGGAGAAGGCTCCGTCTTGATCCTCCCAACAAGCTCTACTTTCCTTATGAACCTGGTAAACAAGTTAGGAGCGCCATCGCAATTAAAAACACTTGCAAGTCTCATGTCGCTTTCAAGTGGTATTTGACTATGTTTAAGTTTGTGGAGCCACCAGAGAACAATGAGAAACCAATTGATCAGAAAAGCAGGGTTAAGTTTAAAATCATGAGCTTAAAAGTGAAAGGCGAAATGGACTATGTACCAGAACTGTTTGATGAGCAAAGGGATCATGTAGCTGTGGAGCAAATTTTGCGTGTCATTTTTCTGGACCCTGAACACCCTTGCCCTGCTTTGGATAAGCTTAAACGGCTGCTAGCTGAGGCTGAGGCTGCATTGGAAGCAAGAAAGAAGCCCCCAGAGGAGACAGGTCCTCGAGTAGCTGGGGAAGGACTTGTTATAGATGAATGGAAAGAAAGAAGAGAAAGATACCTGGCCAGACAGCAGGTTGAAGTGGTAGATTCTGTGTAA
Predicted protein sequences of Glyma12g11670
>Glyma12g11670.2   sequence type=predicted peptide   gene model=Glyma12g11670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPFWQTTHASSTSSTTTFSMHHSVHHQSQILQSLDRSTHQPSTTVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGKQVRSAIAIKNTCKSHVAFKWYLTMFKFVEPPENNEKPIDQKSRVKFKIMSLKVKGEMDYVPELFDEQRDHVAVEQILRVIFLDPEHPCPALDKLKRLLAEAEAALEARKKPPEETGPRVAGEGLVIDEWKERRERYLARQQVEVVDSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo