SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g11582): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g11582): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g11582

Feature Type:gene_model
Chromosome:Gm12
Start:9667221
stop:9667762
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g11582
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21100AT Annotation by Michelle Graham. TAIR10: damaged DNA binding protein 1B | chr4:11258916-11265309 REVERSE LENGTH=1088 SoyBaseE_val: 5.00E-43ISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010100GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of photomorphogenesis SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048608GO-bp Annotation by Michelle Graham. GO Biological Process: reproductive structure development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003684GO-mf Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10644Panther DNA REPAIR/RNA PROCESSING CPSF FAMILY JGI ISS
PTHR10644:SF3Panther SPLICEOSOMAL PROTEIN SAP 130 JGI ISS
UniRef100_B9SKT9UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA repair protein xp-E, putative n=1 Tax=Ricinus communis RepID=B9SKT9_RICCO SoyBaseE_val: 1.00E-43ISS
UniRef100_UPI0002339271UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339271 related cluster n=1 Tax=unknown RepID=UPI0002339271 SoyBaseE_val: 1.00E-44ISS

Expression Patterns of Glyma12g11582
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g11582 not represented in the dataset
Glyma12g11582 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g11582 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g106200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g11582
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g11582
>Glyma12g11582.1   sequence type=CDS   gene model=Glyma12g11582   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTAATAAAACTAAATCTACAGCTTGATGCAAAAGGTTCTTATGTGGAAGTATTGGAAAGGTATGTCAATTTGGGGCCTATTGTTGACTTCCATGTGGTTGTAACTTGCTTTGGAGCTTACAATGGAATAGGGATTAATGAACAGGCATCGGTAGAACTTCAAGGTATCAAAGGAATGTGGTCACTAAGATCCTCAATAGATGATCCTTTTGATACTTTTTTGGTTGTGAGTTTTATAAGTGAAACAAGAATCTTAGCAATGAATCTTGAGGATGAGCTGGAAGAAACTGAGATTGAGGGATTCTGTTCTTAA
Predicted protein sequences of Glyma12g11582
>Glyma12g11582.1   sequence type=predicted peptide   gene model=Glyma12g11582   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLIKLNLQLDAKGSYVEVLERYVNLGPIVDFHVVVTCFGAYNGIGINEQASVELQGIKGMWSLRSSIDDPFDTFLVVSFISETRILAMNLEDELEETEIEGFCS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo