|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G55850 | AT | Annotation by Michelle Graham. TAIR10: RPM1-interacting protein 4 (RIN4) family protein | chr5:22603617-22604951 FORWARD LENGTH=114 | SoyBase | E_val: 1.00E-15 | ISS |
| GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF05627 | PFAM | Cleavage site for pathogenic type III effector avirulence factor Avr | JGI | ISS | |
| UniRef100_B9S9V8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NOI, putative n=1 Tax=Ricinus communis RepID=B9S9V8_RICCO | SoyBase | E_val: 7.00E-14 | ISS |
| UniRef100_I1LRT4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LRT4_SOYBN | SoyBase | E_val: 6.00E-32 | ISS |
|
Glyma12g11010 not represented in the dataset |
Glyma12g11010 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g102200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g11010.2 sequence type=CDS gene model=Glyma12g11010 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTAAGGAATTATTTTAAAAATATTTTGAGTCTTTATTTTGCATTGGCTAATGATGTCAATCATCCAACCTCAGCTGAGGGTTTCACAGTGATTTTTAATAAGGCCAGGGATGAGAAAAAGACAGGTGGCAACCCAGATTCACCAGGAAAGACTGCCACTGATCCTCATAGCAAACCTGCAGTAGAGCCTAGCAAAACACAAACTGTAAGATGTTCTTGA
>Glyma12g11010.2 sequence type=predicted peptide gene model=Glyma12g11010 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLRNYFKNILSLYFALANDVNHPTSAEGFTVIFNKARDEKKTGGNPDSPGKTATDPHSKPAVEPSKTQTVRCS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||