SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g11000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g11000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g11000

Feature Type:gene_model
Chromosome:Gm12
Start:9014139
stop:9015686
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g11000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51260AT Annotation by Michelle Graham. TAIR10: HAD superfamily, subfamily IIIB acid phosphatase | chr5:20832222-20833466 REVERSE LENGTH=257 SoyBaseE_val: 1.00E-28ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003993GO-mf Annotation by Michelle Graham. GO Molecular Function: acid phosphatase activity SoyBaseN/AISS
PF03767PFAM HAD superfamily, subfamily IIIB (Acid phosphatase) JGI ISS
UniRef100_G7L8K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acid phosphatase n=1 Tax=Medicago truncatula RepID=G7L8K1_MEDTR SoyBaseE_val: 2.00E-31ISS
UniRef100_UPI000233C8CDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C8CD related cluster n=1 Tax=unknown RepID=UPI000233C8CD SoyBaseE_val: 3.00E-39ISS

Expression Patterns of Glyma12g11000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g11000 not represented in the dataset
Glyma12g11000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g11000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g102100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g11000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g11000
>Glyma12g11000.2   sequence type=CDS   gene model=Glyma12g11000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCTTGAGGTCTTTGACCACGAGAAGTTTAACAATTGGGTGGAGAAGGGTGTAGCTCCAGCCATTGAACCCAGTTTAAAGCTCTATGAAGATGTTTTGAATCTGGGATTCAAGGTTATTCTACTCACAGGATGGAGTGAAAGGCACAGGAGTGTCACTGTTGATAATTTGATCAATGTTGGGTTTAAGGAATGGGACCAGCTCATACTA
Predicted protein sequences of Glyma12g11000
>Glyma12g11000.2   sequence type=predicted peptide   gene model=Glyma12g11000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLEVFDHEKFNNWVEKGVAPAIEPSLKLYEDVLNLGFKVILLTGWSERHRSVTVDNLINVGFKEWDQLIL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo