SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g09310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g09310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g09310

Feature Type:gene_model
Chromosome:Gm12
Start:7131145
stop:7131889
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g09310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G08960AT Annotation by Michelle Graham. TAIR10: phosphotyrosyl phosphatase activator (PTPA) family protein | chr4:5746326-5747994 FORWARD LENGTH=392 SoyBaseE_val: 2.00E-48ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0019211GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activator activity SoyBaseN/AISS
PTHR10012Panther PHOSPHOTYROSYL PHOSPHATASE ACTIVATOR JGI ISS
PF03095PFAM Phosphotyrosyl phosphate activator (PTPA) protein JGI ISS
UniRef100_B6TQY2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein phosphatase 2A activator 2 n=1 Tax=Zea mays RepID=B6TQY2_MAIZE SoyBaseE_val: 6.00E-47ISS
UniRef100_I1LRE8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LRE8_SOYBN SoyBaseE_val: 5.00E-119ISS

Expression Patterns of Glyma12g09310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g09310 not represented in the dataset
Glyma12g09310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g09310
ParalogEvidenceComments
Glyma11g19110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g09310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma12g09310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g09310
>Glyma12g09310.1   sequence type=CDS   gene model=Glyma12g09310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCCTCCTCCCCTCTCGCCACCGGCACCTGCTGCAAGTGCGGCGGCCCCACCACCTTCGCCCCCCCTCCCCAAACCCCCACCTTCACCTCCCCTCCCCCAACCTACCGCCCCATCCGCGCCCCCGCCATCCCCCCCGACCCCAACTCCACCCGCGCCATCATCCTCTCCCCGGGCCCACAATCCCAAAAAGAGCTTCCTGAGTGCAATGCTGTGTGGGGACTTGATGATTTTCACTTTCTACCCTTCATATTTGGGTCTTCGCAGTTGATTGCTCAAAGAGATATTTTGGAGAATTTCTTTAATGAGTATATGAACCTTGCTGGCATTGCCTTTGTCAAGAAGGTGAAGAAGGGGGTGTTTGATGAGCATTCACCCATGTTGGATGATATCAGTGGGGTGCCCAATTGGAATAAGGTGAACAGTGGGTTGCTCAAGATGTATAAAGCTGAGGTCTTGGAGAAGGTCCCCATCATGCAGCATTTTCTTTTCGGGTCGATTATT
Predicted protein sequences of Glyma12g09310
>Glyma12g09310.1   sequence type=predicted peptide   gene model=Glyma12g09310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SSSPLATGTCCKCGGPTTFAPPPQTPTFTSPPPTYRPIRAPAIPPDPNSTRAIILSPGPQSQKELPECNAVWGLDDFHFLPFIFGSSQLIAQRDILENFFNEYMNLAGIAFVKKVKKGVFDEHSPMLDDISGVPNWNKVNSGLLKMYKAEVLEKVPIMQHFLFGSII






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo