Glyma12g08800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g08800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g08800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g08800

Feature Type:	gene_model
Chromosome:	Gm12
Start:	6524712
stop:	6525852
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g08800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G08170	AT	Annotation by Michelle Graham. TAIR10: Histone superfamily protein \| chr1:2562941-2563672 REVERSE LENGTH=243	SoyBase	E_val: 3.00E-40	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
KOG1744	KOG	Histone H2B	JGI		ISS
PTHR23428	Panther	HISTONE H2B	JGI		ISS
PTHR23428:SF2	Panther	CAMP RESPONSE ELEMENT-BINDING PROTEIN	JGI		ISS
PF00125	PFAM	Core histone H2A/H2B/H3/H4	JGI		ISS
UniRef100_F2CXB9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone H2B n=1 Tax=Hordeum vulgare subsp. vulgare RepID=F2CXB9_HORVD	SoyBase	E_val: 9.00E-38	ISS
UniRef100_I1LRA5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LRA5_SOYBN	SoyBase	E_val: 8.00E-162	ISS

Expression Patterns of Glyma12g08800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g08800 not represented in the dataset	Glyma12g08800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g08800

Paralog	Evidence	Comments
Glyma11g19720	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g08800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g082700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g08800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g08800

Limit To All Plant Sequences

>Glyma12g08800.1   sequence type=CDS   gene model=Glyma12g08800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCAAAACGTGCTGAGAAGCTAGTGGTCAGATCCACCAAGAAAGTTGTGGAATCAAGTGTGCTGGTTTCTGTTGTAGGCAAAAGACTAACCCGTGGAAAAAAAGATACTCAAACAACTGATGGAGAAGAAGAAGTAGGTAGCCAAGAGCATCTGGTGGTCATTCCTATTCAAGAAGTGACTCCTCAAGCACAAAAGGATTCACCTAACTCTGCCATCACCACAGAAAACAAAGCTGAGCAAGAGAACAATACTCAAGATGGTGGAGTCGAAAATAATCAAGAGGAAGAGGAAGAGCATGAGGAAGTGAAAGAGAAGAAGAATAAGGCCAAGACCCCAAAAGGGAAAAATGGGAAGGAGAAAAAAAGAGGGAGAAAAAAGGGTAGGAGAAGTGTTGAAGGGTACCAGAGGTATGTGTATAGGGTGTTGAAGCAAGTGCACCCTGAAATGGGAATTTCTTCCAAGTGCATGACTGTTCTGAACAACTTGATGAATGACATGTTTGAGAGGCTGGCTTTTGAGGCTTCTAAGCTGAAGGACTACACTGGACACATGACATTGTCTTCAAGGGAGATTCAAGGAGCAGTGAGGCTGGTTTTGCCAGGAGAACTTGGAAAGCATGCAATTGCTGAAGGGGTCAAAGCTGTTAACAACTACACATCCTATGATGCTTGA

Predicted protein sequences of Glyma12g08800

Limit To All Plant Sequences

>Glyma12g08800.1   sequence type=predicted peptide   gene model=Glyma12g08800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPKRAEKLVVRSTKKVVESSVLVSVVGKRLTRGKKDTQTTDGEEEVGSQEHLVVIPIQEVTPQAQKDSPNSAITTENKAEQENNTQDGGVENNQEEEEEHEEVKEKKNKAKTPKGKNGKEKKRGRKKGRRSVEGYQRYVYRVLKQVHPEMGISSKCMTVLNNLMNDMFERLAFEASKLKDYTGHMTLSSREIQGAVRLVLPGELGKHAIAEGVKAVNNYTSYDA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain