Glyma12g08785 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g08785): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g08785): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g08785

Feature Type:	gene_model
Chromosome:	Gm12
Start:	6520372
stop:	6520962
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g08785

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05200	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr3:1477377-1478573 FORWARD LENGTH=398	SoyBase	E_val: 1.00E-23	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0009814	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction	SoyBase	N/A	ISS
GO:0009816	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR22764	Panther	RING FINGER PROTEIN 11 (SID 1669) (NEDD4 WW DOMAIN-BINDING PROTEIN 2).	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_B9SCM2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9SCM2_RICCO	SoyBase	E_val: 6.00E-24	ISS
UniRef100_I1LRA4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LRA4_SOYBN	SoyBase	E_val: 5.00E-69	ISS

Expression Patterns of Glyma12g08785

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g08785 not represented in the dataset	Glyma12g08785 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g08785

Paralog	Evidence	Comments
Glyma11g19735	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g08785 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g08785

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g08785

Limit To All Plant Sequences

>Glyma12g08785.1   sequence type=CDS   gene model=Glyma12g08785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATTCTGGAACCGCAGATTGCTACTACAGAACGAGGACGTTCCCCTCTCGATGCCACCTCTCTCTCACACTCACACCAAACACGCCACTAACGCATCATCATCCTCGCCGCCGCAATCTTCGGCTTTCCAATTCCAAAGCCCACTGCAGGTTTCGATTCCTCCAGTTTTTTCATCGAGTGTGGCCTACGTCTTCCTCATCCTCTTCACCACCTTCTTCTTCGTCGGCTTCGTCTTCCTCTACTTCCGCCAGTTCGCCTCCGACGCCGCCGCCGCCGGATCCTACCGCCGCCGCTGGGAGGAGGGCGCGGCAGCGGCGGCGGAGGCAAAGAAGTGCCTGCCGGTGGTGGCGCACTGCGGGGAGGGGTGCGCGGAGTGCGCGATATGCCTGGAGGAGCTGCGAGAGGGGGACGCGGTGAAGATGATTCCGTACTGCAAGCACGTGTTCCACCCGCACTGCATTGACACGTGGCTCGATAAGCATGTCACGTGCCCCGTGTGCCGGTGCAGTGAGCTGCTATGTGGAGAAGAGGTGGTGGGGTCGGTGTCAGCGAGAAGACAAGAAGAAGTGGTTCTAAATTTGGATTAG

Predicted protein sequences of Glyma12g08785

Limit To All Plant Sequences

>Glyma12g08785.1   sequence type=predicted peptide   gene model=Glyma12g08785   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFWNRRLLLQNEDVPLSMPPLSHTHTKHATNASSSSPPQSSAFQFQSPLQVSIPPVFSSSVAYVFLILFTTFFFVGFVFLYFRQFASDAAAAGSYRRRWEEGAAAAAEAKKCLPVVAHCGEGCAECAICLEELREGDAVKMIPYCKHVFHPHCIDTWLDKHVTCPVCRCSELLCGEEVVGSVSARRQEEVVLNLD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain