SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g07730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g07730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g07730

Feature Type:gene_model
Chromosome:Gm12
Start:5347812
stop:5350101
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g07730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60190AT Annotation by Michelle Graham. TAIR10: Cysteine proteinases superfamily protein | chr5:24235319-24235999 FORWARD LENGTH=226 SoyBaseE_val: 2.00E-86ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006914GO-bp Annotation by Michelle Graham. GO Biological Process: autophagy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
GO:0019784GO-mf Annotation by Michelle Graham. GO Molecular Function: NEDD8-specific protease activity SoyBaseN/AISS
KOG3246 KOG Sentrin-specific cysteine protease (Ulp1 family) JGI ISS
PTHR22875Panther SENTRIN/SUMO-SPECIFIC PROTEASE, SENP8 JGI ISS
PF02902PFAM Ulp1 protease family, C-terminal catalytic domain JGI ISS
UniRef100_C6TMM4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TMM4_SOYBN SoyBaseE_val: 1.00E-168ISS
UniRef100_G7JRH9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sentrin-specific protease n=1 Tax=Medicago truncatula RepID=G7JRH9_MEDTR SoyBaseE_val: 3.00E-130ISS

Expression Patterns of Glyma12g07730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g07730 not represented in the dataset
Glyma12g07730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g07730
ParalogEvidenceComments
Glyma11g15741 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g07730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g072600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g07730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g07730
>Glyma12g07730.1   sequence type=CDS   gene model=Glyma12g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAAATCAAAAGCAGATGAGAAGATTCTCAGCTACAACGATGTGGTGCTTAGGCGATCTGATTTACACATCCTTAGTGGTCCATATTTTTTGAATGATCGGATTATCGAGTTTTATTTCAGCTATCTTTCTTCATGTCATCCCTCTCAGGATATCCTGCTGGTTCCACCATCCATTGCATTTTGGATAATACAATGCCCTGTCGCTGAGGCTCTTGGTGATTTCATAGAACCCCTTCATTTGCCTGATAAGACACTGGTTATATTTCCCGTCAATGACAATGATGACGTTGACAGAGCTGAAGGTGGTTCTCATTGGAGCTTACTTGCATATTACCGCAACGCTAATTTGTTTGTTCACCACGATAGTTGCAGAAGCATGAATGCAGCACCCGCCAAGCAACTCTATAAAGGCATTGCTGGATACATGGGATCCTCTGGATCAGCTTCTGAGGCTAGCTTTCTGGAATGCACTAATTCACCCATGCAAGACAATGGTTATGACTGTGGCTTATATGCCACAGCCATAGCCAGAGTAATATGCAACTGGCATGTAAATCATAAAAATGCTGATACAAATGATCTGTGGTTTTCTGCGGTGAAGGAACAGGTTTCCCCATCTGCTGTCGCCAGCATGCGAGGCGAGATCCTGGCCTTGATCAGAGATCTAATGGCAAGACATTGA
Predicted protein sequences of Glyma12g07730
>Glyma12g07730.1   sequence type=predicted peptide   gene model=Glyma12g07730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRKSKADEKILSYNDVVLRRSDLHILSGPYFLNDRIIEFYFSYLSSCHPSQDILLVPPSIAFWIIQCPVAEALGDFIEPLHLPDKTLVIFPVNDNDDVDRAEGGSHWSLLAYYRNANLFVHHDSCRSMNAAPAKQLYKGIAGYMGSSGSASEASFLECTNSPMQDNGYDCGLYATAIARVICNWHVNHKNADTNDLWFSAVKEQVSPSAVASMRGEILALIRDLMARH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo