Glyma12g07395 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g07395): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g07395): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g07395

Feature Type:	gene_model
Chromosome:	Gm12
Start:	5075274
stop:	5076462
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g07395

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G07980	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C10 \| chr1:2473523-2474910 REVERSE LENGTH=206	SoyBase	E_val: 5.00E-20	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PTHR10252	Panther	HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED	JGI		ISS
PTHR10252:SF23	Panther	HISTONE-LIKE TRANSCRIPTION FACTOR (CBF/NF-Y) FAMIL	JGI		ISS
PF00808	PFAM	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	JGI		ISS
UniRef100_G7JPE7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase epsilon subunit n=1 Tax=Medicago truncatula RepID=G7JPE7_MEDTR	SoyBase	E_val: 6.00E-35	ISS
UniRef100_I1LQX3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQX3_SOYBN	SoyBase	E_val: 3.00E-43	ISS

Expression Patterns of Glyma12g07395

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g07395 not represented in the dataset	Glyma12g07395 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g07395 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g069200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g07395

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g07395

Limit To All Plant Sequences

>Glyma12g07395.1   sequence type=CDS   gene model=Glyma12g07395   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCCATATCAGGACAATAATTAAGCTCGAAGATCCTGATTTGCGTGTTTCAAAGGACGCGTTGATGGCCGTCAACACTGCCGCGGAGACGTTCGTTGAGCAATTTGTGCAAGAAGCTTATACCTGTTGTGCTGAGGACCGCAAGAAATGTCTCAGTTATGATCACCTAGCAAACGTTGTTAGCAAGGATAAGAGATATGACTTTCTTGTTGATAATTCGTATCCCTATTTTGTTCCTGAGAGAGTGAAAGCTGAGGATGCATTGCGTGAGAGAAGTGCAGCAGGCAAAGGAGGATGA

Predicted protein sequences of Glyma12g07395

Limit To All Plant Sequences

>Glyma12g07395.1   sequence type=predicted peptide   gene model=Glyma12g07395   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHIRTIIKLEDPDLRVSKDALMAVNTAAETFVEQFVQEAYTCCAEDRKKCLSYDHLANVVSKDKRYDFLVDNSYPYFVPERVKAEDALRERSAAGKGG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain