SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g06770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g06770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g06770

Feature Type:gene_model
Chromosome:Gm12
Start:4617229
stop:4618913
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G46560AT Annotation by Michelle Graham. TAIR10: Tim10/DDP family zinc finger protein | chr3:17138632-17139301 FORWARD LENGTH=93 SoyBaseE_val: 3.00E-50ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0045039GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005758GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space SoyBaseN/AISS
GO:0042719GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space protein transporter complex SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
KOG3479 KOG Mitochondrial import inner membrane translocase, subunit TIM9 JGI ISS
PTHR10898Panther MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9 JGI ISS
PF02953PFAM Tim10/DDP family zinc finger JGI ISS
UniRef100_B4FU14UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit Tim9 n=1 Tax=Zea mays RepID=B4FU14_MAIZE SoyBaseE_val: 3.00E-51ISS
UniRef100_C6T294UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T294_SOYBN SoyBaseE_val: 9.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g06770 not represented in the dataset

Glyma12g06770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g14830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g063000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g06770.1   sequence type=CDS   gene model=Glyma12g06770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAGAGCATGCTAGCGGATTTGGATTCGCTCCCTGAGGCTGATAAGCAAAGAATGACTGTCATGATCGATCAGCTCCAAATCCGTGACAGTCTGAGAATGTATAATTCACTGGTTGAGAGATGCTTTAATGATTGTGTTGACACATTTAAGCATAAATCCCTGCAAAAGCAAGAGGAAACCTGTGTTCGAAGATGTGCAGAGAAATTTCTCAAGCATTCTATGCGGGTTGGCATGAGGTTTGCCGAGCTCAACCAAGGAGCTGCTACACAAGATTAA

>Glyma12g06770.1   sequence type=predicted peptide   gene model=Glyma12g06770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKSMLADLDSLPEADKQRMTVMIDQLQIRDSLRMYNSLVERCFNDCVDTFKHKSLQKQEETCVRRCAEKFLKHSMRVGMRFAELNQGAATQD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo