SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g06606): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g06606): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g06606

Feature Type:gene_model
Chromosome:Gm12
Start:4498545
stop:4498985
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00490AT Annotation by Michelle Graham. TAIR10: ribulose-bisphosphate carboxylases | chrC:54958-56397 FORWARD LENGTH=479 SoyBaseE_val: 9.00E-75ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0015977GO-bp Annotation by Michelle Graham. GO Biological Process: carbon fixation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0016984GO-mf Annotation by Michelle Graham. GO Molecular Function: ribulose-bisphosphate carboxylase activity SoyBaseN/AISS
PF00016PFAM Ribulose bisphosphate carboxylase large chain, catalytic domain JGI ISS
UniRef100_B7U9F4UniRef Annotation by Michelle Graham. Best UniRef hit: Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) n=1 Tax=Ulmus minor RepID=B7U9F4_9ROSA SoyBaseE_val: 7.00E-81ISS
UniRef100_B7U9F4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (Fragment) n=1 Tax=Ulmus minor RepID=B7U9F4_9ROSA SoyBaseE_val: 7.00E-81ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g06606 not represented in the dataset

Glyma12g06606 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g061600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g06606.1   sequence type=CDS   gene model=Glyma12g06606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTACCGTAGTAAGTAAACATGAAGGGAAAAGAGAAATCACTTTAGGTTTTCTTGATTTACTACGTGATGATTTTGTTGAAAAAGATCGAAGTTGTGGTATTTATTTCACTCAGGATTGGATTTCTCTACCAGGTGTATTGTGTGTTGTTTTCGGAGGTATTCACGTTTGGCATATGCCTGCTCAGACCAAGATCTTTGGAGATGATTCTGTACTCCAATTTGGCAGAGGAACTTTAGGACACCTTTGGGGAAATGCCCCAGGTGCTGTAGCTAATCGAGTAGCTCTTGAAGCATATGTGCAGGCTCGAAATGAAGGACATCTTGCTTGTGAAGGTAATGAAATTATCAGTGAGACTAGCAAATGGAGTCCTAAATTAGCTGCTGCTTGTGAAGTATGGAAGAAGATCAAATTTGACTTTGAAGCAATGGATACTTTGTAA

>Glyma12g06606.1   sequence type=predicted peptide   gene model=Glyma12g06606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTVVSKHEGKREITLGFLDLLRDDFVEKDRSCGIYFTQDWISLPGVLCVVFGGIHVWHMPAQTKIFGDDSVLQFGRGTLGHLWGNAPGAVANRVALEAYVQARNEGHLACEGNEIISETSKWSPKLAAACEVWKKIKFDFEAMDTL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo