SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g06320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g06320

Feature Type:gene_model
Chromosome:Gm12
Start:4289325
stop:4291506
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G29350AT Annotation by Michelle Graham. TAIR10: senescence-associated gene 13 | chr2:12601036-12602222 FORWARD LENGTH=269 SoyBaseE_val: 6.00E-116ISS
GO:0002213GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to insect SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004022GO-mf Annotation by Michelle Graham. GO Molecular Function: alcohol dehydrogenase (NAD) activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PTHR24310Panther FAMILY NOT NAMED JGI ISS
PTHR24310:SF66Panther JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_B9S3D8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tropinone reductase, putative n=1 Tax=Ricinus communis RepID=B9S3D8_RICCO SoyBaseE_val: 1.00E-126ISS
UniRef100_I1LQL3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQL3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g06320 not represented in the dataset

Glyma12g06320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g059300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g06320.1   sequence type=CDS   gene model=Glyma12g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGCCAAACATTGCTAGCAGATGGTCTTTACAGGGGATGACAGCTCTCGTCACTGGTGGATCCAAAGGAATCGGATATGCTATCGTGGAGGAGTTGGCACAGCTTGGAGCCACTGTGCACACTTGCGCTCGGAACGAAGCTGAACTCAACGAATCCTTAAATGAATGGAACACAAAAGGATACAGAGTAACTGGTTCCGTCTGTGACGTGGCGTCTCGTGCAGAAAGACAAGACCTCATTGCTAGACTCTCCTCTGAGTTTAATGGCAAACTCAATATACTTGTAAACAACGTGGGAACAAACATATGGAAAGACCTCTTGGAATACACAGAGGAAGACTTTTTATTTCTGGTGAATACGAATTTGCAATCTGCTTTCCACCTATGCCAGCTTGCACATCCTCTCCTAAAAGCCTCCGAAGCTGCAAGCATCGTTTTCATATCCTCCATTGGAGGTGTGGTATCAATAAATTTAGGATCCGTTGTATATAGTGCAACAAAAGGAGCAATGAATCAAATGACAAAAAATTTGGCATGTGAATGGGCCAAAGACAATATAAGGACTAATTGCGTTGCACCAGGAATGATCAGAACCCCTGCTGCTGATGAGTATTTAAAAGAGGGAAAAATTGCTAATGCATACATTCCACGAACCCCTCTTGGACGGTTCGGAGAAGGAGACGAGGTGTCTTCGGTTGTGGCATTCCTCTGCTTACCCGCAGCCTCTTACGTAACTGGACAGATAATTTGTGTTGATGGCGGCTTCACTGTCAACGGCCTATACATAAGCTAG

>Glyma12g06320.1   sequence type=predicted peptide   gene model=Glyma12g06320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEPNIASRWSLQGMTALVTGGSKGIGYAIVEELAQLGATVHTCARNEAELNESLNEWNTKGYRVTGSVCDVASRAERQDLIARLSSEFNGKLNILVNNVGTNIWKDLLEYTEEDFLFLVNTNLQSAFHLCQLAHPLLKASEAASIVFISSIGGVVSINLGSVVYSATKGAMNQMTKNLACEWAKDNIRTNCVAPGMIRTPAADEYLKEGKIANAYIPRTPLGRFGEGDEVSSVVAFLCLPAASYVTGQIICVDGGFTVNGLYIS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo