|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G47120 | AT | Annotation by Michelle Graham. TAIR10: BAX inhibitor 1 | chr5:19136071-19137585 FORWARD LENGTH=247 | SoyBase | E_val: 9.00E-11 | ISS |
| GO:0000038 | GO-bp | Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process | SoyBase | N/A | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006983 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER overload response | SoyBase | N/A | ISS |
| GO:0006984 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER-nucleus signaling pathway | SoyBase | N/A | ISS |
| GO:0007154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell communication | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0043066 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of apoptotic process | SoyBase | N/A | ISS |
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0005635 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| UniRef100_G7JYK5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Bax inhibitor n=1 Tax=Medicago truncatula RepID=G7JYK5_MEDTR | SoyBase | E_val: 1.00E-23 | ISS |
| UniRef100_UPI000233D8C8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D8C8 related cluster n=1 Tax=unknown RepID=UPI000233D8C8 | SoyBase | E_val: 2.00E-31 | ISS |
|
Glyma12g06000 not represented in the dataset |
Glyma12g06000 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g056200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g06000.1 sequence type=CDS gene model=Glyma12g06000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TTAAGATGGTGGCTAATGTTGTCAGAGTCTCTCTTCATGTTTTGTGGAACATTGGGGGTTTTCTCACTACGGTGGCTTCCATTGGAAAAATGGTTTGGTTGCTATCTATCTACACCCCTTTTTGAAGAGCAAAAGAGGTTGTGTCTATTGATGGCTTTGGCCTTGTTCCAGGGCGCTTCCATTAGACCTCTGATTGATTTGGCTATTGCCATTGATCCTAGCCTTATTGTTAGCACATTTGTGTGGCAACTTCTTTGGCTTTTGCATAGGGAGTACCTCCACCTTGGTGGCTTGCTTTCTTCTAGGTTGTCCATTCTTATGTGGTTGCCCTTTGCTTCCTCTCCCTTTTGGGGGTTCAATAACACTATTTAA
>Glyma12g06000.1 sequence type=predicted peptide gene model=Glyma12g06000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LRWWLMLSESLFMFCGTLGVFSLRWLPLEKWFGCYLSTPLFEEQKRLCLLMALALFQGASIRPLIDLAIAIDPSLIVSTFVWQLLWLLHREYLHLGGLLSSRLSILMWLPFASSPFWGFNNTI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||