SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g06000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g06000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g06000

Feature Type:gene_model
Chromosome:Gm12
Start:4088910
stop:4089313
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47120AT Annotation by Michelle Graham. TAIR10: BAX inhibitor 1 | chr5:19136071-19137585 FORWARD LENGTH=247 SoyBaseE_val: 9.00E-11ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006983GO-bp Annotation by Michelle Graham. GO Biological Process: ER overload response SoyBaseN/AISS
GO:0006984GO-bp Annotation by Michelle Graham. GO Biological Process: ER-nucleus signaling pathway SoyBaseN/AISS
GO:0007154GO-bp Annotation by Michelle Graham. GO Biological Process: cell communication SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0043066GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of apoptotic process SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005635GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_G7JYK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bax inhibitor n=1 Tax=Medicago truncatula RepID=G7JYK5_MEDTR SoyBaseE_val: 1.00E-23ISS
UniRef100_UPI000233D8C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D8C8 related cluster n=1 Tax=unknown RepID=UPI000233D8C8 SoyBaseE_val: 2.00E-31ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g06000 not represented in the dataset

Glyma12g06000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g056200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g06000.1   sequence type=CDS   gene model=Glyma12g06000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTAAGATGGTGGCTAATGTTGTCAGAGTCTCTCTTCATGTTTTGTGGAACATTGGGGGTTTTCTCACTACGGTGGCTTCCATTGGAAAAATGGTTTGGTTGCTATCTATCTACACCCCTTTTTGAAGAGCAAAAGAGGTTGTGTCTATTGATGGCTTTGGCCTTGTTCCAGGGCGCTTCCATTAGACCTCTGATTGATTTGGCTATTGCCATTGATCCTAGCCTTATTGTTAGCACATTTGTGTGGCAACTTCTTTGGCTTTTGCATAGGGAGTACCTCCACCTTGGTGGCTTGCTTTCTTCTAGGTTGTCCATTCTTATGTGGTTGCCCTTTGCTTCCTCTCCCTTTTGGGGGTTCAATAACACTATTTAA

>Glyma12g06000.1   sequence type=predicted peptide   gene model=Glyma12g06000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LRWWLMLSESLFMFCGTLGVFSLRWLPLEKWFGCYLSTPLFEEQKRLCLLMALALFQGASIRPLIDLAIAIDPSLIVSTFVWQLLWLLHREYLHLGGLLSSRLSILMWLPFASSPFWGFNNTI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo