Glyma12g05940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g05940

Feature Type:	gene_model
Chromosome:	Gm12
Start:	4026080
stop:	4027714
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g05940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20820	AT	Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein \| chr3:7280930-7282027 FORWARD LENGTH=365	SoyBase	E_val: 2.00E-150	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
KOG4579	KOG	Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue	JGI		ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF701	Panther		JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
PF08263	PFAM	Leucine rich repeat N-terminal domain	JGI		ISS
UniRef100_H6V788	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Leucine-rich repeat receptor-like protein n=1 Tax=Malus x domestica RepID=H6V788_MALDO	SoyBase	E_val: 4.00E-158	ISS
UniRef100_I1LQH4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LQH4_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma12g05940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g05940

Paralog	Evidence	Comments
Glyma11g13970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g05940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g055500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g05940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g05940

Limit To All Plant Sequences

>Glyma12g05940.1   sequence type=CDS   gene model=Glyma12g05940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCATGCATGCACAAATCGGCATCTCCAAATTTTCTCTTTCCGTCTTCTCAAAACCTCCAAACTACAATACAATGGCAAGAGTTTGGCTCACGGCGCCGCTAACGGCGCTGTTACTGTTCGCATTCTCCTCCGCCGTTAGTTCGTGTCCGCCGTCGGACCTGGCGGCGCTGCTGGCCTTCAAATCCGCTGTCCGGGAGTCCAACGGCGGAATATTCAACTCGTGGACCGGCACCGACTGCTGCCGCAACTGGTACGGCGTCTCCTGCGACCGCAACTCTCGCCGCGTCGCCGAGATCAGCCTCCGCGCCGGTCCCGTCTACACCACCTTCGAGAAGCCCTTCCGTCCGGGCTACATGTCCGGTTCCATCTCGCCGGAGATTTGCAAGCTCACGTACCTCTCCAGCATCATCATCACCGACTGGCAGGGAATCTCCGGCGAGATCCCGCGCTGCATCACCTCCCTCTCCTTCCTCCGCATCATCGACCTCACCGGAAACCGAATCTCCGGCACTCTCCCCGCCGACATCGGAAGGCTCCAGTACCTGACTCTGCTCAGCGCCGCCGACAACGTCATCGCCGGCGAAATCCCGCCGTCGCTGACGAGTGTGACCGGTTTGATGTATCTTGACCTCCGTAACAACCAGATCTCCGGGCCCATCCCACAAAGCCTGGGCCGGCTTCAAATGCTGAGCCGTGTCCTTTTAAGCGGGAACCAAATTAGTGGGCCCATTCCGCGCTCATTCTGTGAGATATATCGTCTCGTGGATCTTGACCTCTCTAATAACCGTTTGCTCGGGCCCATCCCTGAAGCCTTGGGCCGAATGAAGGTTCTGTCAACGTTGAAGTTTGATAATAACAGGCTTTCGGGAAGTATACCAGCGAGCCTTTTGGGCTCGGGTATTAGCGAGTTGAACTTGAGCCACAATTATTTGGAGGGTAATATACCTGACTCGTTTGGAGGTACCTCTTATTTCACGTTACTGGACTTATCCTATAATAACCTCAGGGGCCCAATACCCAAATCCATGTCTTCCTCTTCCTACGTTGGGTTTTTGGACTTTAGCCACAACCACCTCTGCGGTCCAATTCCAAGCAGCTACAGTGATGCCGATGCGTCGTCGTTTGATTACAATGATTGCCTCTGTGGGAAGCCACTCAAAGCTTGCTAA

Predicted protein sequences of Glyma12g05940

Limit To All Plant Sequences

>Glyma12g05940.1   sequence type=predicted peptide   gene model=Glyma12g05940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLMHAQIGISKFSLSVFSKPPNYNTMARVWLTAPLTALLLFAFSSAVSSCPPSDLAALLAFKSAVRESNGGIFNSWTGTDCCRNWYGVSCDRNSRRVAEISLRAGPVYTTFEKPFRPGYMSGSISPEICKLTYLSSIIITDWQGISGEIPRCITSLSFLRIIDLTGNRISGTLPADIGRLQYLTLLSAADNVIAGEIPPSLTSVTGLMYLDLRNNQISGPIPQSLGRLQMLSRVLLSGNQISGPIPRSFCEIYRLVDLDLSNNRLLGPIPEALGRMKVLSTLKFDNNRLSGSIPASLLGSGISELNLSHNYLEGNIPDSFGGTSYFTLLDLSYNNLRGPIPKSMSSSSYVGFLDFSHNHLCGPIPSSYSDADASSFDYNDCLCGKPLKAC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain