SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g05910

Feature Type:gene_model
Chromosome:Gm12
Start:3993783
stop:3994531
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65360AT Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr5:26120099-26120509 REVERSE LENGTH=136 SoyBaseE_val: 5.00E-94ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
KOG1745 KOG Histones H3 and H4 JGI ISS
PTHR11426Panther HISTONE H3 JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_I1K4W0UniRef Annotation by Michelle Graham. Best UniRef hit: Histone H3 n=1 Tax=Glycine max RepID=I1K4W0_SOYBN SoyBaseE_val: 3.00E-92ISS
UniRef100_I1K4W0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H3 n=1 Tax=Glycine max RepID=I1K4W0_SOYBN SoyBaseE_val: 3.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g13940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g055200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g05910.1   sequence type=CDS   gene model=Glyma12g05910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCGTACGAAGCAAACCGCAAGGAAGTCCACCGGAGGAAAAGCTCCGAGGAAGCAACTCGCCACGAAAGCAGCACGCAAGTCCGCTCCGGCGACCGGCGGCGTGAAGAAGCCACACCGTTTCAGGCCGGGTACGGTGGCGCTGAGGGAGATCCGAAAATACCAGAAGAGCACCGAGCTTCTCATAAGGAAGCTTCCTTTCCAGAGACTCGTAAGGGAAATCGCTCAGGACTTCAAGACCGATCTCCGCTTCCAGAGCAGCGCTGTCTCCGCTCTGCAGGAAGCCGCGGAGGCCTACCTTGTTGGGCTGTTCGAGGACACCAACCTCTGCGCCATTCACGCCAAGAGAGTTACCATTATGCCCAAGGACATTCAGCTTGCTCGTAGGATTAGGGGCGAGAGGGCTTAG

>Glyma12g05910.1   sequence type=predicted peptide   gene model=Glyma12g05910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo