|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G42260 | AT | Annotation by Michelle Graham. TAIR10: beta glucosidase 12 | chr5:16898712-16900235 FORWARD LENGTH=507 | SoyBase | E_val: 4.00E-34 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004553 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds | SoyBase | N/A | ISS |
| GO:0043169 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cation binding | SoyBase | N/A | ISS |
| PTHR10353 | Panther | GLYCOSIDE HYDROLASES | JGI | ISS | |
| PF00232 | PFAM | Glycosyl hydrolase family 1 | JGI | ISS | |
| UniRef100_A0SXU2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glycosylhydrolase family 1 (Fragment) n=1 Tax=Leucaena leucocephala RepID=A0SXU2_LEULE | SoyBase | E_val: 6.00E-44 | ISS |
| UniRef100_UPI000233D12E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D12E related cluster n=1 Tax=unknown RepID=UPI000233D12E | SoyBase | E_val: 3.00E-47 | ISS |
|
Glyma12g05833 not represented in the dataset |
Glyma12g05833 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g05833.1 sequence type=CDS gene model=Glyma12g05833 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TTCATCTTTGGCACCGCCTCCTCCGCATACCAGTACGAAGGTGCTGCAAATGAAGGAGGCAGAGGACCAAGTACATGGGATACCTATTCTCATAAATATCCAGAAAAAATATCGGATAGAAGCAATGGAGATGTAGCAGTTGATCAATATCATCACTATAAGGAAGATGTTGGGATCATGAAGTATATGAACACTGATGCTTACAGATTCTCCATCTCTTGGTCAAGGATATTGCCAAGTAATCAAATCGGATTTAGTTTCATCCTTACCAGTTTCAGTTAG
>Glyma12g05833.1 sequence type=predicted peptide gene model=Glyma12g05833 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high FIFGTASSAYQYEGAANEGGRGPSTWDTYSHKYPEKISDRSNGDVAVDQYHHYKEDVGIMKYMNTDAYRFSISWSRILPSNQIGFSFILTSFS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||