|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G54420 | AT | Annotation by Michelle Graham. TAIR10: homolog of carrot EP3-3 chitinase | chr3:20145935-20147034 FORWARD LENGTH=273 | SoyBase | E_val: 1.00E-33 | ISS |
| GO:0002679 | GO-bp | Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response | SoyBase | N/A | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0006865 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid transport | SoyBase | N/A | ISS |
| GO:0009626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010262 | GO-bp | Annotation by Michelle Graham. GO Biological Process: somatic embryogenesis | SoyBase | N/A | ISS |
| GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
| GO:0015824 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proline transport | SoyBase | N/A | ISS |
| GO:0016998 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0004568 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chitinase activity | SoyBase | N/A | ISS |
| GO:0008061 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chitin binding | SoyBase | N/A | ISS |
| PTHR22595 | Panther | CHITINASE-RELATED | JGI | ISS | |
| PTHR22595:SF7 | Panther | CLASS IV CHITINASE | JGI | ISS | |
| PF00182 | PFAM | Chitinase class I | JGI | ISS | |
| UniRef100_Q7X9F8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Class IV chitinase n=1 Tax=Galega orientalis RepID=Q7X9F8_9FABA | SoyBase | E_val: 3.00E-40 | ISS |
| UniRef100_UPI000233D617 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D617 related cluster n=1 Tax=unknown RepID=UPI000233D617 | SoyBase | E_val: 4.00E-78 | ISS |
|
Glyma12g05301 not represented in the dataset |
Glyma12g05301 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g049100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g05301.1 sequence type=CDS gene model=Glyma12g05301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGCAAGTTACTACACATTCGTGTTGCTGGGTTTGTGGCAACCTTTGTCATCATGGTGATGACGATGGTGCCCATAAACGTGAGTGCTCAAAACATTGGTGATGACATCGTCACACAAGAATTCTTCAACAGCATAATCGATCAGGCTGATGCTAGTTGTGCAGGGAAGAACTTCTACTCACGAGATGTTTTCCTTAATGCTCACAATTCCTACAATGAGTTTGGTAGGCTTGGAAACCAGGATGACTCCAAGCGTGAGGTTGCAGCTTCTTTTGCCCATTTCACCCATGAAACTGGACATTTTTGCTACATAGAAGAGATTAATGGAGCAGCAGGGGACTAG
>Glyma12g05301.1 sequence type=predicted peptide gene model=Glyma12g05301 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSKLLHIRVAGFVATFVIMVMTMVPINVSAQNIGDDIVTQEFFNSIIDQADASCAGKNFYSRDVFLNAHNSYNEFGRLGNQDDSKREVAASFAHFTHETGHFCYIEEINGAAGD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||