Glyma12g05040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g05040

Feature Type:	gene_model
Chromosome:	Gm12
Start:	3355418
stop:	3357461
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g05040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34360	AT	Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein \| chr4:16432011-16433752 FORWARD LENGTH=248	SoyBase	E_val: 7.00E-42	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
PTHR12176	Panther	UNCHARACTERIZED	JGI		ISS
UniRef100_B9RZD5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: S-adenosylmethionine-dependent methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RZD5_RICCO	SoyBase	E_val: 7.00E-39	ISS
UniRef100_I1LQ68	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LQ68_SOYBN	SoyBase	E_val: 7.00E-73	ISS

Expression Patterns of Glyma12g05040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g05040

Paralog	Evidence	Comments
Glyma11g12910	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g05040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g046300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g05040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g05040

Limit To All Plant Sequences

>Glyma12g05040.2   sequence type=CDS   gene model=Glyma12g05040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTATTGTTCGTGGACAGTGGTAACCCATGGAATCCAAAGCCTGAAACTATATCCAAGGTCATGGCCACGTTGAAAGGTGTTCACGGGGTTTTGAAAGCTGGTGGCACATTTATCTCAGTAACTTTTGGACAGCCACATTTCAGGCGCCCTATATTTAATGCACCAGATTTCAGCTGGTCTGTTGAGTGGACTACTTTTGGTGAAACCTTTCACTATTTTGTCTATGTTCTGAAAAAGGGACAGAGATCGTCACATGATGATATTCCACCCGTTAAGAGGTTTGAAGCACGCCTATTAATTTACTTCATGAAGAGTTAG

Predicted protein sequences of Glyma12g05040

Limit To All Plant Sequences

>Glyma12g05040.2   sequence type=predicted peptide   gene model=Glyma12g05040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVLFVDSGNPWNPKPETISKVMATLKGVHGVLKAGGTFISVTFGQPHFRRPIFNAPDFSWSVEWTTFGETFHYFVYVLKKGQRSSHDDIPPVKRFEARLLIYFMKS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain