Glyma12g04031 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g04031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g04031): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g04031

Feature Type:	gene_model
Chromosome:	Gm12
Start:	2642127
stop:	2643230
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g04031

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G16570	AT	Annotation by Michelle Graham. TAIR10: GLN phosphoribosyl pyrophosphate amidotransferase 1 \| chr2:7180424-7182124 REVERSE LENGTH=566	SoyBase	E_val: 4.00E-73	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009113	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleobase biosynthetic process	SoyBase	N/A	ISS
GO:0009116	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process	SoyBase	N/A	ISS
GO:0009560	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009532	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0004044	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amidophosphoribosyltransferase activity	SoyBase	N/A	ISS
PTHR11907	Panther	AMIDOPHOSPHORIBOSYLTRANSFERASE	JGI		ISS
PF00310	PFAM	Glutamine amidotransferases class-II	JGI		ISS
UniRef100_I1LPW3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LPW3_SOYBN	SoyBase	E_val: 2.00E-96	ISS
UniRef100_I1LPW4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Amidophosphoribosyltransferase n=1 Tax=Glycine max RepID=I1LPW4_SOYBN	SoyBase	E_val: 6.00E-77	ISS

Expression Patterns of Glyma12g04031

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g04031 not represented in the dataset	Glyma12g04031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g04031 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma12g04031

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g04031

Limit To All Plant Sequences

>Glyma12g04031.1   sequence type=CDS   gene model=Glyma12g04031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGACGACTACGATAAGCCGCGAAGAATGCGGCGTGGTGGGCATATACGGCGACCCCGAGGCCTTGCACCTCTGCTACCTTGCCCTACATGCCCTCCAGCACCGCGGCCAAGAAGGCACCGGAATCGTCACCGTCAACAACAACGTCCTCCAACCCATCACCGGCATGGGCCTCGTCTCCGAAGTCTTCAACCAACTCCCCGGCAGCCCCTTCATCGGCCACGTCCACTACTCCACTGTCGGTCTGTCCATGCTAAAAAACGTCCAGCCCTTCGTCGCCGGCTACCGCTTCGGCTCCGTCCGCGTGGCCCACAACGGCAACCTCGTCAAACCCTTCCTTCTACGAATCGTTGACGCCTGTGAAAAGCTCAAAGGGGCTTATTCTTTTGTCTTCGTCACCGAGGACAAGCTTGTCGTCGTTCGCGACCCTTTCGGGTTCAGGCCTTTGGTTACGGGAAAGAGAAGCAACGGTATTCAGAGTTTGCACCTCATGTCTCATCTCAACCCAAACAATGCATTTCTGAACATATTTACTTTGCACTTCCCAATTCGGTTGTTTTTGGGAGATCTGTGTATGAGTCTCGTAGACAATTTGGGGAGATTTTGGCTACCAAGAGTCCCGGAGGCTGGTGCTAAGGAAGTACACATGAGAATTGCGAGTTCTTGTTACTATGGTGTGGATATACTCTCGAATAAGATGAGTGTGGAGGAGATAATAGACTTTATTGGAACGGATTCACTTGTCTTTTGA

Predicted protein sequences of Glyma12g04031

Limit To All Plant Sequences

>Glyma12g04031.1   sequence type=predicted peptide   gene model=Glyma12g04031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTTTISREECGVVGIYGDPEALHLCYLALHALQHRGQEGTGIVTVNNNVLQPITGMGLVSEVFNQLPGSPFIGHVHYSTVGLSMLKNVQPFVAGYRFGSVRVAHNGNLVKPFLLRIVDACEKLKGAYSFVFVTEDKLVVVRDPFGFRPLVTGKRSNGIQSLHLMSHLNPNNAFLNIFTLHFPIRLFLGDLCMSLVDNLGRFWLPRVPEAGAKEVHMRIASSCYYGVDILSNKMSVEEIIDFIGTDSLVF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain