|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G38840 | AT | Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr4:18125174-18125473 REVERSE LENGTH=99 | SoyBase | E_val: 1.00E-15 | ISS |
GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PF02519 | PFAM | Auxin responsive protein | JGI | ISS | |
UniRef100_G7JL36 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein-like protein n=1 Tax=Medicago truncatula RepID=G7JL36_MEDTR | SoyBase | E_val: 6.00E-24 | ISS |
UniRef100_I1LPV0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPV0_SOYBN | SoyBase | E_val: 9.00E-38 | ISS |
Glyma12g03880 not represented in the dataset |
Glyma12g03880 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.12g034700 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g03880.2 sequence type=CDS gene model=Glyma12g03880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGTTTTCGTTTACCTGGTATCAAAAAAGCATCATTAAACCAAGCATCTTCAAAAGCTGTGGACGTGCCAAAGGGCTACCTTCCAGTCTATCAAACTTCATTTCAAGACATGCTCAGTCTATCCGATGAAGAATTTGGGTATAAACGTCCAATGGGTGGTCTTATGATTCCTTGTGGAGAAAATGTGTTCTTAGATATCACTTCTCGATCGCTTGAATTAATAGGTTCTAACCCTACAATGATAAGACTGACATAG
>Glyma12g03880.2 sequence type=predicted peptide gene model=Glyma12g03880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGFRLPGIKKASLNQASSKAVDVPKGYLPVYQTSFQDMLSLSDEEFGYKRPMGGLMIPCGENVFLDITSRSLELIGSNPTMIRLT*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||