Glyma12g03600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g03600

Feature Type:	gene_model
Chromosome:	Gm12
Start:	2412341
stop:	2413964
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g03600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34990	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 32 \| chr4:16661370-16662289 REVERSE LENGTH=274	SoyBase	E_val: 3.00E-107	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009751	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_Q0PJM1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB54 n=1 Tax=Glycine max RepID=Q0PJM1_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q0PJM1	UniRef	Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB54 n=1 Tax=Glycine max RepID=Q0PJM1_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma12g03600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g03600

Paralog	Evidence	Comments
Glyma11g11450	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g03600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g032200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g03600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g03600

Limit To All Plant Sequences

>Glyma12g03600.1   sequence type=CDS   gene model=Glyma12g03600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGGTCCCCTTGCTGTGAGAAAGCTCACACAAACAAAGGTGCATGGACTAAAGAAGAAGATGACAGACTCATATCTTATATTCGAGCTCACGGAGAAGGCTGCTGGCGTTCACTCCCCAAAGCCGCCGGCCTTCTCCGGTGCGGCAAGAGCTGCCGTCTCCGGTGGATCAACTACCTCCGCCCCGACCTCAAAAGAGGTAACTTTACCGAAGAAGAAGATGAACTCATCATCAAACTCCACAGTCTCCTCGGTAACAAGTGGTCTTTGATAGCTGGAAGATTGCCGGGGAGAACAGACAATGAAATAAAGAATTATTGGAACACGCACATAAGAAGGAAGCTTTTGAACAGAGGAATCGACCCTGCTACTCATAGGCCACTCAACGAAGCTGCTTCTGCTGCAACTGTTACAACTGCCACCACTAATATATCTTTTGGGAAACAACAAGAACAAGAGACAAGTTCTAGTAACGGAAGCGTTGTTAAAGGTTCCATCTTGGAACGCTGCCCTGACTTGAACCTTGAGTTAACCATTAGTCCTCCTCGCCAACAACAACCTCAGAAGAATCTTTGTTTTGTTTGCAGTTTGGGTTTGAACAACAGCAAGGATTGTAGCTGCAACGTTGCCAACACTGTTACTGTTACTGTCAGCAACACTACTCCTTCTTCTGCTGCTGCTGCTGCTGCTGCTGCTTATGATTTCTTGGGCATGAAAACCAACGGTGTTTGGGATTGCACCCGCTTGGAAATGAAATGA

Predicted protein sequences of Glyma12g03600

Limit To All Plant Sequences

>Glyma12g03600.1   sequence type=predicted peptide   gene model=Glyma12g03600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRGIDPATHRPLNEAASAATVTTATTNISFGKQQEQETSSSNGSVVKGSILERCPDLNLELTISPPRQQQPQKNLCFVCSLGLNNSKDCSCNVANTVTVTVSNTTPSSAAAAAAAAYDFLGMKTNGVWDCTRLEMK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain