SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g03311): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g03311): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g03311

Feature Type:gene_model
Chromosome:Gm12
Start:2181326
stop:2182105
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G50270AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr1:18622044-18623834 FORWARD LENGTH=596 SoyBaseE_val: 8.00E-63ISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PTHR24015:SF47Panther SUBFAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_B9RTH1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RTH1_RICCO SoyBaseE_val: 5.00E-50ISS
UniRef100_UPI000233C27FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C27F related cluster n=1 Tax=unknown RepID=UPI000233C27F SoyBaseE_val: 2.00E-117ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g03311 not represented in the dataset

Glyma12g03311 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g11110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g029400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g03311.1   sequence type=CDS   gene model=Glyma12g03311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATCGCAAGTTCCAAGAAGGACTTCGTGCCTTCTGGGACATGATATTGGACAATGTTGCGCCCAATGATTTCACACTCTTAAGTGTTCTTAGTGTCTGTGCTCGCATGGGGGCTTTGGATCAAGGACGGTTAATTGCGTTAGGGACTGCATTGGTGGATATGTACGCAAAATGTGGGTGTGTTGATGAAGCTTTAAGGGTATTTGAAAACTTGCAAGTTAAGAACGTGTACACTTGGACAGCAATAATTAATGGTTTGGCTGTGCATGGGGATGCATTAGGAGCATTGAATATCTTCTCTTGCATGTTAAAAAGTGGTATTCAACCCAATGAAGTTACCTTTGTCGGAGTTCTTGCTGCATGTTCTCATGGAGGTTTTGTAGAGGAAGGGAAAAGGTTATTTGAATCGATGAAATATGTATATCATTTCAAGCCAGAGATGGACCATTATGCTTTTGAAATGGGTGAACATATAGGGAATTTATTGGTAAATCAGCCACCAAACCATAGTGGTAATTATGCACTTATGGCTAACTTGTATAAAATGTTTCAAAACTGGGAAGTGTCTGCCCAGGTCAGGAAGCTCATAAAAGGATTACGAGTGGAAAAGACTCCAAGATATAGTTTGACAGAGGTGGATGATTTTAATTCATGA

>Glyma12g03311.1   sequence type=predicted peptide   gene model=Glyma12g03311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHRKFQEGLRAFWDMILDNVAPNDFTLLSVLSVCARMGALDQGRLIALGTALVDMYAKCGCVDEALRVFENLQVKNVYTWTAIINGLAVHGDALGALNIFSCMLKSGIQPNEVTFVGVLAACSHGGFVEEGKRLFESMKYVYHFKPEMDHYAFEMGEHIGNLLVNQPPNHSGNYALMANLYKMFQNWEVSAQVRKLIKGLRVEKTPRYSLTEVDDFNS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo