Glyma12g02680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g02680

Feature Type:	gene_model
Chromosome:	Gm12
Start:	1738589
stop:	1742171
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g02680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21190	AT	Annotation by Michelle Graham. TAIR10: ER lumen protein retaining receptor family protein \| chr2:9080916-9082642 FORWARD LENGTH=269	SoyBase	E_val: 3.00E-178	ISS
GO:0006621	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein retention in ER lumen	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0046923	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ER retention sequence binding	SoyBase	N/A	ISS
KOG3106	KOG	ER lumen protein retaining receptor	JGI		ISS
PTHR10585	Panther	ER LUMEN PROTEIN RETAINING RECEPTOR-RELATED	JGI		ISS
PF00810	PFAM	ER lumen protein retaining receptor	JGI		ISS
UniRef100_B9STD7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ER lumen protein retaining receptor, putative n=1 Tax=Ricinus communis RepID=B9STD7_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1LPG3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPG3_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma12g02680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g02680

Paralog	Evidence	Comments
Glyma11g10390	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g02680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g023900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g02680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g02680

Limit To All Plant Sequences

>Glyma12g02680.1   sequence type=CDS   gene model=Glyma12g02680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGACCTCAGAGAACGTCGATCCACGCCGTCACGACATGGGTGAGGCGACAGCCCCCAAAGGTGAAGGCTTTTCTCGCCGTCGTTTCCGGCATGGCGGCCCTCGTCCTCCTTCGCTTCATCGTCCACGATCACGACAACCTCTTCGTCGCTGCCGAGGCTGTCCACTCCCTCGGAATTTCCGTCCTCATCTACAAGCTCATGAAGGAGAGGACATGTGCTGGGTTATCACTCAAATCCCAGGAATTAACGGCTATCTTTTTAGCTGTTAGGCTGTACTGCAGTTTTGTCATGGAATATGATATCCACACCTTACTTGATTTCGCTACTTTCGTAACAACGCTCTGGGTTATATACATGATTCGTTTTAAGCTGAAGGCTAGCTACATGGAAGAGAAGGATAACTTTGCAATATACTATGTGGTGGTACCCTGTGCTGTGTTAGCCTTGCTCATTCATCCATCAACTTCTCATCATTTATTAAACAGGATTTCCTGGGCATTCTGTGTATATCTAGAAGCTGTCTCAGTCCTGCCCCAACTGCGGGTCATGCAGAACACCAAGATTGTTGAACCTTTCACAGCTCATTATGTATTTGCATTGGGTGTTGCAAGATTCTTGAGCTGCGCTCATTGGGTTCTTCAGGTGTTAGATAGCCGTGGGCATTTGCTGGTGGCCTTGGGGTATGGTTTATGGCCATCAATGGTTCTTATCTCGGAAATTGTCCAGACCTTCATCTTAGCAGATTTCTGTTACTATTATGTCAAAAGTGTCTTCGGGGGACAACTTGTTCTACGTCTTCCCTCTGGAGTGGTGTGA

Predicted protein sequences of Glyma12g02680

Limit To All Plant Sequences

>Glyma12g02680.1   sequence type=predicted peptide   gene model=Glyma12g02680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRPQRTSIHAVTTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLIYKLMKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDFATFVTTLWVIYMIRFKLKASYMEEKDNFAIYYVVVPCAVLALLIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDSRGHLLVALGYGLWPSMVLISEIVQTFILADFCYYYVKSVFGGQLVLRLPSGVV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain