Report for Sequence Feature Glyma12g02560
Feature Type: gene_model
Chromosome: Gm12
Start: 1677081
stop: 1677377
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma12g02560
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G29450 AT
Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr1:10305981-10306406 REVERSE LENGTH=141
SoyBase E_val: 1.00E-17 ISS
GO:0009733 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF02519 PFAM
Auxin responsive protein
JGI ISS
UniRef100_B9P5Y9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SAUR family protein n=1 Tax=Populus trichocarpa RepID=B9P5Y9_POPTR
SoyBase E_val: 2.00E-18 ISS
UniRef100_I1LPF2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LPF2_SOYBN
SoyBase E_val: 5.00E-65 ISS
Expression Patterns of Glyma12g02560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma12g02560
Paralog Evidence Comments
Glyma11g10260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma12g02560 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.12g022900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma12g02560
Coding sequences of Glyma12g02560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g02560.1 sequence type=CDS gene model=Glyma12g02560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
AACAAGGGACACTTGCTTGTTTATATACCCCTTAAATATCTTAGCACAAACGTGTTCAGGGAGCTACTAAATTGGTACGAAGAGGAGTTTGGGTTACCTTCCAATGGACCTATTACGTTGCCTTGTGATAGCGTGTTATTGGACTACGTAATCTTGTTATTTCGAGAACACGTTCCTGAACAAGTTGAGAAGGCTTTGATCACTTCAATGGTTGCATGTCATCACGAGGCTTCATCATCATCATCTTCGCTTGCTCTTAGGCAGAGCAACGAGCCAATGATTATCTATGGCTTTTGA
Predicted protein sequences of Glyma12g02560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g02560.1 sequence type=predicted peptide gene model=Glyma12g02560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
NKGHLLVYIPLKYLSTNVFRELLNWYEEEFGLPSNGPITLPCDSVLLDYVILLFREHVPEQVEKALITSMVACHHEASSSSSSLALRQSNEPMIIYGF*