Glyma12g02040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g02040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g02040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g02040

Feature Type:	gene_model
Chromosome:	Gm12
Start:	1244594
stop:	1246390
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g02040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21045	AT	Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein \| chr2:9027858-9028805 FORWARD LENGTH=169	SoyBase	E_val: 9.00E-61	ISS
GO:0000041	GO-bp	Annotation by Michelle Graham. GO Biological Process: transition metal ion transport	SoyBase	N/A	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0010359	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
KOG1530	KOG	Rhodanese-related sulfurtransferase	JGI		ISS
PTHR13253	Panther	FAMILY NOT NAMED	JGI		ISS
PF00581	PFAM	Rhodanese-like domain	JGI		ISS
UniRef100_G7ILL1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thiosulfate sulfurtransferase n=1 Tax=Medicago truncatula RepID=G7ILL1_MEDTR	SoyBase	E_val: 7.00E-78	ISS
UniRef100_I1LP77	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LP77_SOYBN	SoyBase	E_val: 2.00E-103	ISS

Expression Patterns of Glyma12g02040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g02040 not represented in the dataset	Glyma12g02040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g02040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g017900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g02040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g02040

Limit To All Plant Sequences

>Glyma12g02040.1   sequence type=CDS   gene model=Glyma12g02040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCCCCCAAGGATCATCAAAATGTTGTAACCATAGATGTCCATGCTGCCAAAGATCTGCTCAATTCATCTGGTTATCGTTATCTGGATGTTAGGTCAGTTGAGGAATTCAACAAAAGCCATGTTGAGAATGCTCATAATGTCCCCTATGTCTTCATCACAGAAGCAGGACGGGTGAAAAATCCAGATTTTGTTGACCAGGTGGCAGCAATATGCAAGACTGAGGATCATTTGATTGTGGCTTGCAATAGTGGAGGAAGATCACTCCGAGCCTCCGTTGATCTGCTTGATTCAGGATTTAAGAATATTGTTAACATGGGGGGAGGCTACTCTGCGTGGGTGGATGCTGGATTTGCCGGGAACAAGCCAGGAGAAGACCTCAAAACTAGCTGCAAGTTCCGTCCTAACATCGCAAAACCCACTGCACAACCATAG

Predicted protein sequences of Glyma12g02040

Limit To All Plant Sequences

>Glyma12g02040.1   sequence type=predicted peptide   gene model=Glyma12g02040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSPKDHQNVVTIDVHAAKDLLNSSGYRYLDVRSVEEFNKSHVENAHNVPYVFITEAGRVKNPDFVDQVAAICKTEDHLIVACNSGGRSLRASVDLLDSGFKNIVNMGGGYSAWVDAGFAGNKPGEDLKTSCKFRPNIAKPTAQP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain