Glyma12g01760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g01760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g01760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g01760

Feature Type:	gene_model
Chromosome:	Gm12
Start:	1084977
stop:	1085933
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma12g01760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G22440	AT	Annotation by Michelle Graham. TAIR10: Zinc-binding alcohol dehydrogenase family protein \| chr1:7922560-7924759 FORWARD LENGTH=386	SoyBase	E_val: 3.00E-17	ISS
GO:0000041	GO-bp	Annotation by Michelle Graham. GO Biological Process: transition metal ion transport	SoyBase	N/A	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0010359	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF4	Panther	ARYL-ALCOHOL DEHYDROGENASE	JGI		ISS
UniRef100_G7JZ48	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Alcohol dehydrogenase class-3 n=1 Tax=Medicago truncatula RepID=G7JZ48_MEDTR	SoyBase	E_val: 1.00E-37	ISS
UniRef100_UPI000233D1B4	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D1B4 related cluster n=1 Tax=unknown RepID=UPI000233D1B4	SoyBase	E_val: 2.00E-57	ISS

Expression Patterns of Glyma12g01760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g01760 not represented in the dataset	Glyma12g01760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma12g01760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.12g015000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma12g01760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma12g01760

Limit To All Plant Sequences

>Glyma12g01760.1   sequence type=CDS   gene model=Glyma12g01760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCGTCCAAACCGATCAGGCAGGGATTCAAACATGGGGAAAGTCACATTTGGGAACAGGGAAAACAATAGTAATTAGTGTAGGAGCTGAACCTATTTTGCCAGTAGGTCTTTTTGCCATTCTGCATGGTAGAACTTTGAAAGGTACTCTTTTTGGAGGGCTAAAAGCCGTATCAGACCTTTCAATTGTAGCTGAGAAATGCCAGAAAAAGGAATTTCCTCTTCAAGAACTCTTCACCCATGAAGTCACATTGGCCGATATAAACAAAGCATTTGAGCTAGTAAAACAACCCAATTGTGTCAAAGTTGTCATCAATATGTCATAG

Predicted protein sequences of Glyma12g01760

Limit To All Plant Sequences

>Glyma12g01760.1   sequence type=predicted peptide   gene model=Glyma12g01760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCVQTDQAGIQTWGKSHLGTGKTIVISVGAEPILPVGLFAILHGRTLKGTLFGGLKAVSDLSIVAEKCQKKEFPLQELFTHEVTLADINKAFELVKQPNCVKVVINMS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain