SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G55300 | AT | Annotation by Michelle Graham. TAIR10: DNA topoisomerase I alpha | chr5:22424837-22429045 REVERSE LENGTH=916 | SoyBase | E_val: 6.00E-38 | ISS |
| GO:0001676 | GO-bp | Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid metabolic process | SoyBase | N/A | ISS |
| GO:0002213 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to insect | SoyBase | N/A | ISS |
| GO:0006259 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA metabolic process | SoyBase | N/A | ISS |
| GO:0006265 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA topological change | SoyBase | N/A | ISS |
| GO:0006338 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin remodeling | SoyBase | N/A | ISS |
| GO:0006633 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009791 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic development | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0010016 | GO-bp | Annotation by Michelle Graham. GO Biological Process: shoot morphogenesis | SoyBase | N/A | ISS |
| GO:0010075 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0019827 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stem cell maintenance | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048645 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ formation | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005694 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chromosome | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003917 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA topoisomerase type I activity | SoyBase | N/A | ISS |
| GO:0003918 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA topoisomerase type II (ATP-hydrolyzing) activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0031490 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chromatin DNA binding | SoyBase | N/A | ISS |
| PTHR10290 | Panther | DNA TOPOISOMERASE TYPE I | JGI | ISS | |
| PF02919 | PFAM | Eukaryotic DNA topoisomerase I, DNA binding fragment | JGI | ISS | |
| UniRef100_I1LP26 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LP26_SOYBN | SoyBase | E_val: 6.00E-54 | ISS |
| UniRef100_O24307 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Topoisomerase I n=1 Tax=Pisum sativum RepID=O24307_PEA | SoyBase | E_val: 4.00E-38 | ISS |
|
Glyma12g01620 not represented in the dataset |
Glyma12g01620 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.12g013500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma12g01620.1 sequence type=CDS gene model=Glyma12g01620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTGTTAAGACTTCTGATGAACCGAATTTAGCTCATGATTTTGATGATGATGATGATGATGGGCCGGTAATTTACAAAAGGTACTCATCATCTAAGAAAAATCAACTGCACTCAGATGTAAGGAAGTCAAGTTCTCACAGTCACGATGGACAGATTTCTAATGCTCCTTCTGCTAAGCCATCACCCGTGAAGCCTTCTGTAGGCATCTCAAATGCTTCAAATTCTCTTATCAACACCTCCTCTATGAAGTTGCCTGTGGCAAATCCAAAATCACCTTCATTGGGAGATAAACAGAAAATGTCCATTGATGTTAAGGAGAAATCAAAATCTATCGATTACTGTGCTAAAGATTACTGTGAAGATTCAGAAGATGATGAGGATAATAAACCGTTTAGTGTTGGCGCTGGTGATGGGCAAAATAAACGGACTACTTTGGTTCACAATGCTGTCATTTTCCCTCCATACCAGCCGCATGGGGTAAAGATGCTCTACAAGGGTAAACCAGCTGAGCAAGAGGAGCCATGCGAGATACAGACAGACTACATGCCAAAAGATAGGTTCAAGGAAAATTTCTGGAATGACTGGCGAAAGTTGCTTGGAAGAAATCATGTTATCCAGAACTTGAAAGATTGTGATTTTATTCCAATCTATGACTGGTACCAAAGTGAGAAGGAAAAGAAGAAAGGAATGACTGCAGAAGTGTACCCTAGAATGGGAAATCAAAATCACAGAGGCACAGCTAGCATGGGGCAGTAG
>Glyma12g01620.1 sequence type=predicted peptide gene model=Glyma12g01620 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAVKTSDEPNLAHDFDDDDDDGPVIYKRYSSSKKNQLHSDVRKSSSHSHDGQISNAPSAKPSPVKPSVGISNASNSLINTSSMKLPVANPKSPSLGDKQKMSIDVKEKSKSIDYCAKDYCEDSEDDEDNKPFSVGAGDGQNKRTTLVHNAVIFPPYQPHGVKMLYKGKPAEQEEPCEIQTDYMPKDRFKENFWNDWRKLLGRNHVIQNLKDCDFIPIYDWYQSEKEKKKGMTAEVYPRMGNQNHRGTASMGQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
