SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma12g01490

Feature Type:gene_model
Chromosome:Gm12
Start:895193
stop:896156
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma12g01490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G47440AT Annotation by Michelle Graham. TAIR10: tonoplast intrinsic protein 5;1 | chr3:17482054-17482987 FORWARD LENGTH=256 SoyBaseE_val: 9.00E-56ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0015840GO-bp Annotation by Michelle Graham. GO Biological Process: urea transport SoyBaseN/AISS
GO:0048235GO-bp Annotation by Michelle Graham. GO Biological Process: pollen sperm cell differentiation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0090406GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015204GO-mf Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF53Panther SUBFAMILY NOT NAMED JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_G7IGS0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin MIP family n=1 Tax=Medicago truncatula RepID=G7IGS0_MEDTR SoyBaseE_val: 4.00E-89ISS
UniRef100_UPI000233D1ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D1AD related cluster n=1 Tax=unknown RepID=UPI000233D1AD SoyBaseE_val: 3.00E-114ISS

Expression Patterns of Glyma12g01490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma12g01490
ParalogEvidenceComments
Glyma09g35860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma12g01490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g012300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma12g01490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma12g01490
>Glyma12g01490.2   sequence type=CDS   gene model=Glyma12g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGGGAAGTTGATGGCTGATGCTTCACTGAACCCAACAAGTTTGGTTGTGGTTGGCATTGCAAGCGCATTTGCTTTGTCTTCTGTTCTTTATATCGCATGGGACATCTCAGGTGGAAACGTGAATCCGGCTGTGACCTTTGCAATGGCGGCAGTGGGAGGCCACGTTGCTCAACTCAGAGCCTCTGTTATGGCTTGCCTTGTTCTAAGGGTAATTGTTGTTGGAATGGTGTTAGAGGGTATTCTGACATTTGTTTTGGTGTACAGAGTGTATGCAGCCAGGGACCCTAGGCATGGTCCAATGAGTTCCACTGGCATACTTGTAGTTGGCTTAATGGCTGGGGCAAGTGTCTTGGCCACAGCTCCATTCTCCGGCGGCTCAATGAACCCTGCATGTGCTTTTGGCTCGGCTGCCATTGCAGGCAGTTTCAGGAACCAAGCAGTGTATTGGGTTGGACCCTTGATTGGTGCTACAATAGCTGGCCTTCTTTATGACAATGTGCTGTTCCGATCTCAACCCACAGATTCAATTCAAGGAATTGGGGTGTAA
Predicted protein sequences of Glyma12g01490
>Glyma12g01490.2   sequence type=predicted peptide   gene model=Glyma12g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGKLMADASLNPTSLVVVGIASAFALSSVLYIAWDISGGNVNPAVTFAMAAVGGHVAQLRASVMACLVLRVIVVGMVLEGILTFVLVYRVYAARDPRHGPMSSTGILVVGLMAGASVLATAPFSGGSMNPACAFGSAAIAGSFRNQAVYWVGPLIGATIAGLLYDNVLFRSQPTDSIQGIGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo