SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g00770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g00770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g00770

Feature Type:gene_model
Chromosome:Gm12
Start:384020
stop:390393
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71692AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 12 | chr1:26952903-26954939 REVERSE LENGTH=211 SoyBaseE_val: 3.00E-78ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0048589GO-bp Annotation by Michelle Graham. GO Biological Process: developmental growth SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_B9SKA4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mads box protein, putative n=1 Tax=Ricinus communis RepID=B9SKA4_RICCO SoyBaseE_val: 8.00E-97ISS
UniRef100_I1LNS4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=core eudicotyledons RepID=I1LNS4_SOYBN SoyBaseE_val: 2.00E-149ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g00770 not represented in the dataset

Glyma12g00770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g36590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g005000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g00770.1   sequence type=CDS   gene model=Glyma12g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCGCGGAAAGGTTCAGCTGAAGAGAATTGAGAACCCTGTGCACAGGCAAGTTACCTTCTGCAAGCGCCGAGCTGGGCTTCTTAAGAAGGCTAAGGAGCTATCTGTGCTGTGCGATGCTGAAATTGGCCTATTCATTTTCTCTGCCCATGGAAAGCTCTATGAACTAGCCACCAAAGGAACCATGCAAGGGCTCATTGAGAGGTACATGAAGTTCTCACGAGGAGCTCAGCCTGAAGCAGCACCTGAAGCACATCCTCTTCTGGATGCTAAAGAGGAAACTAACATGCTAAAACAAGAAATCCAAACATTGCAAAAGGGTATCAGGCATTTGTTTGGAGGAGGAAATAAGACTATGACAATTGATGAATTACAAGTGCTAGAGAAGAATCTCGAAACTTGGATATATCATATTCGTTCAATGAAAATGAACATCATGTTACAAGAAATTCAAGCTTTGAAAGATAAGGAGGGAACACTTAAAGCGGCAAATAAATATCTCCATGATAAGATTGTGGAGAATACTGCAATTTCTAACTTTGCTCAATTTGCTACTGATACTTCGAATTCGTACCCGCTAATCATACAAGATGAGGTTTTTCAACTCTATTAA

>Glyma12g00770.1   sequence type=predicted peptide   gene model=Glyma12g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARGKVQLKRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELATKGTMQGLIERYMKFSRGAQPEAAPEAHPLLDAKEETNMLKQEIQTLQKGIRHLFGGGNKTMTIDELQVLEKNLETWIYHIRSMKMNIMLQEIQALKDKEGTLKAANKYLHDKIVENTAISNFAQFATDTSNSYPLIIQDEVFQLY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo