SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g00680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g00680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g00680

Feature Type:gene_model
Chromosome:Gm12
Start:328352
stop:330130
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25280AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr4:12939068-12940723 REVERSE LENGTH=249 SoyBaseE_val: 8.00E-76ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0046939GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide phosphorylation SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016776GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, phosphate group as acceptor SoyBaseN/AISS
GO:0019205GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity SoyBaseN/AISS
KOG3079 KOG Uridylate kinase/adenylate kinase JGI ISS
PTHR23359Panther ADENYLATE KINASE JGI ISS
PF00406PFAM Adenylate kinase JGI ISS
UniRef100_I1L5R2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase 11 n=1 Tax=Glycine max RepID=I1L5R2_SOYBN SoyBaseE_val: 4.00E-105ISS
UniRef100_I1L5R2UniRef Annotation by Michelle Graham. Best UniRef hit: Adenylate kinase 11 n=1 Tax=Glycine max RepID=I1L5R2_SOYBN SoyBaseE_val: 4.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g00680 not represented in the dataset

Glyma12g00680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g36680 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g00680.2   sequence type=CDS   gene model=Glyma12g00680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGAAAAGGATGGCATTTGCCCCAAACCGCTTATAACTTTTGTTTTAGGAGGCCCTGGTAGTGGAAAAGGTACACAATGTGCAAAAATTGTTGAAACCTTTGGATTTAAGCATCTGAGTGCTGGAGATCTTTTGAGAAGGGAGATGGTTTCTGATAGTGAATATGGCTCAATGATTATGAATACAATTAGAGAAGGAAAAATTGTTCCATCAGGAGTGACTGTCAAATTGATTCTAAGAGAGATGAAATCTAGTGACAATCATAAGTTTCTTATTGATGGCTTCCCTAGAAGCCAGGAGAACCGTATAGCTTTTGAACAAATTGGTCGAATTGATGACAACATAGATACAATCAAGAACCGTCTTAAAGTATTTGAGTCATTAAATCTTCCTGTGATTGACTATTATGCTAAGAAAGGGAAACTTTACAGGATCAATGCAGTGGGAACAGTAGATGAAATATTTGAGCATGTTCGGCCAGTTTTTGAGGCA

>Glyma12g00680.2   sequence type=predicted peptide   gene model=Glyma12g00680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQEKDGICPKPLITFVLGGPGSGKGTQCAKIVETFGFKHLSAGDLLRREMVSDSEYGSMIMNTIREGKIVPSGVTVKLILREMKSSDNHKFLIDGFPRSQENRIAFEQIGRIDDNIDTIKNRLKVFESLNLPVIDYYAKKGKLYRINAVGTVDEIFEHVRPVFEA







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo