SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma12g00210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma12g00210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma12g00210

Feature Type:gene_model
Chromosome:Gm12
Start:3830
stop:5180
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35290AT Annotation by Michelle Graham. TAIR10: glutamate receptor 2 | chr4:16790290-16793461 FORWARD LENGTH=912 SoyBaseE_val: 3.00E-34ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006874GO-bp Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis SoyBaseN/AISS
GO:0006883GO-bp Annotation by Michelle Graham. GO Biological Process: cellular sodium ion homeostasis SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0030007GO-bp Annotation by Michelle Graham. GO Biological Process: cellular potassium ion homeostasis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004970GO-mf Annotation by Michelle Graham. GO Molecular Function: ionotropic glutamate receptor activity SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005217GO-mf Annotation by Michelle Graham. GO Molecular Function: intracellular ligand-gated ion channel activity SoyBaseN/AISS
GO:0005234GO-mf Annotation by Michelle Graham. GO Molecular Function: extracellular-glutamate-gated ion channel activity SoyBaseN/AISS
PTHR18966Panther IONOTROPIC GLUTAMATE RECEPTOR-RELATED JGI ISS
PTHR18966:SF7Panther gb def: agcp6329 [anopheles gambiae str. pest] JGI ISS
PF00497PFAM Bacterial extracellular solute-binding proteins, family 3 JGI ISS
UniRef100_I1KZP1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KZP1_SOYBN SoyBaseE_val: 2.00E-70ISS
UniRef100_I1M634UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamate receptor (Fragment) n=2 Tax=Glycine max RepID=I1M634_SOYBN SoyBaseE_val: 8.00E-50ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma12g00210 not represented in the dataset

Glyma12g00210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g43670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g000100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g00210.1   sequence type=CDS   gene model=Glyma12g00210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTCCCAAATAAATGGCACCAATGCAATTCAAGGATATTGCATAGATATATTCCTAGCTGCCTTTAAATTGCTTCCCTATGCAGTTCAATACAAGTTCATTCTGTTTGGAGATGGAGACAAGAACCCAAGCTACTGTGATCTTGTCAACATGATTACTTCTGATGTTTTTGATGCTGCTGTAGGTGACATTGCGATTGTCTCTGTCCGAACAAAGATTGTGGATTTTACTCGACCATATATAGAGTCGGGGCTAGTTGTGGTTGCTCCAGTAAAAAAAATTGAAGTCAAATGCTTGGGCTTTCTTGTGACCATTTACTCCACATATGTGGGGTGTCACTGCATTTTTTTTCCTCTTTGTTGGAGCATTTCGAGGGTCACTGAGGGAACATATAGTTACAGTTCTTTGCTAGTTAGTCATAACTCATCTTTTAAGTCGTCCACCTATTTTGACAGTTCATGTCCTATTCTTATTCACTTCAAAAATCACGAACCAAATCCGCCCATAAAATATCATCTTTGTCCATATCTGAACCCAAAACGCCTAAATCCAACCTCTTCTCCTCGTTGTTCGTTTGTCCCTCACTCCCCCATGTAG

>Glyma12g00210.1   sequence type=predicted peptide   gene model=Glyma12g00210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MISQINGTNAIQGYCIDIFLAAFKLLPYAVQYKFILFGDGDKNPSYCDLVNMITSDVFDAAVGDIAIVSVRTKIVDFTRPYIESGLVVVAPVKKIEVKCLGFLVTIYSTYVGCHCIFFPLCWSISRVTEGTYSYSSLLVSHNSSFKSSTYFDSSCPILIHFKNHEPNPPIKYHLCPYLNPKRLNPTSSPRCSFVPHSPM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo