SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g37120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g37120): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g37120

Feature Type:gene_model
Chromosome:Gm11
Start:38344588
stop:38348002
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27390AT Annotation by Michelle Graham. TAIR10: translocase outer membrane 20-2 | chr1:9513469-9514912 REVERSE LENGTH=210 SoyBaseE_val: 5.00E-79ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0045040GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial outer membrane SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005741GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane SoyBaseN/AISS
GO:0005742GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane translocase complex SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005744GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR10790Panther UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE SUBUNIT-RELATED JGI ISS
PTHR10790:SF9Panther SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT (TPR) CONTAINING PROTEIN JGI ISS
PF06552PFAM Plant specific mitochondrial import receptor subunit TOM20 JGI ISS
UniRef100_B9RMF2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM20, putative n=1 Tax=Ricinus communis RepID=B9RMF2_RICCO SoyBaseE_val: 3.00E-91ISS
UniRef100_I1LN85UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN85_SOYBN SoyBaseE_val: 2.33E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g37120 not represented in the dataset

Glyma11g37120 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g01030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g250100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g37120.1   sequence type=CDS   gene model=Glyma11g37120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTTTCTCAAGATGATTTTGATCGGTTACTGTTATTCGAACACACGCGAAAGACTGCTGAAGCAAACTACGCAGAGAATCCTCAAGACGCTGATAATCTGACCAGGTGGGGGGGAGCTTTGATCGAGTTGTCGTCATTCCAAGCTCCTAGGGATGCCAAGGCGATGATTGATGATGCCCTTTCGAAGCTGGAGGAGTCTTTGCTGATCAATCCAACTAAGCATGACACTCTTTGGTGCTTGGGAAATGCAAACACGTCTTATGCTTTTCTAATCCCTGATATAACTGAGGCAAAGGGTTATTTTGACAAGGCACTTGAGTATTTCCAGAAAGCTGCGGAGGAGGATCCCGAGAATGACCTCTATAGAAAGTCCTTGCAAGTTGCCGTGAAGGCCCCAGAACTACACATGGAGATCCATAAAAATGGGCTTGGTCTGATGAGTAATGCGGGATCCTCTGCTACTTCAAAAGAAAAGGAATCTAAAAAGCAGAAGAGCAATGACTTTAAGTATGACATATTTGGATGGATTATTCTTGCAGTGGGTATAGTAGCATGGGTGGGAATGGCCAAATCTAACATTCCCCCGCCACCTCCAAGATAA

>Glyma11g37120.1   sequence type=predicted peptide   gene model=Glyma11g37120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFSQDDFDRLLLFEHTRKTAEANYAENPQDADNLTRWGGALIELSSFQAPRDAKAMIDDALSKLEESLLINPTKHDTLWCLGNANTSYAFLIPDITEAKGYFDKALEYFQKAAEEDPENDLYRKSLQVAVKAPELHMEIHKNGLGLMSNAGSSATSKEKESKKQKSNDFKYDIFGWIILAVGIVAWVGMAKSNIPPPPPR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo