SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g37020

Feature Type:gene_model
Chromosome:Gm11
Start:38271176
stop:38273103
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g37020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27930AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF579) | chr1:9731510-9732379 REVERSE LENGTH=289 SoyBaseE_val: 9.00E-124ISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04669PFAM Protein of unknown function (DUF579) JGI ISS
UniRef100_B6TXL0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plant-specific domain TIGR01627 family protein n=1 Tax=Zea mays RepID=B6TXL0_MAIZE SoyBaseE_val: 2.00E-72ISS
UniRef100_I1LN75UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN75_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma11g37020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g37020
ParalogEvidenceComments
Glyma18g00940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g37020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g251000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g37020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g37020
>Glyma11g37020.1   sequence type=CDS   gene model=Glyma11g37020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAACCGTTATTTGGTGCCGGAGAGACGGTGGTTCGTAGGTCTGGCCGTCGTGGGGTTGATCGGCGCGGTGCTATTCCTCAGCAACGCGATCCGAACCTCGGAAACCTCGTACGTGTGTCCGGGGGCGCTCGGGATCCGAAGCAAGACCCGAACCGAATTCAGTTACGACGCGTCACCGATCCAGCTCCGCGCGATTATGCACTACGCGACCTCGCGCGTGGTTCCGCAACAATCGGTGTCGGAGATCAAGATCAGTCTGGACGTCATTAAATCACTGGGCCGGCCCATCAACTTCCTCGTCTTCGGGCTGGGCCACGACTCCCTCATGTGGGCCTCGTTCAACCCGGGCGGCACCACGGTGTTCCTCGAAGAAGATCCAAAGTGGGTCCACTCGATCCTTAAAGACGCGCCTGGCCTGCGGGCCCACACGGTGCGTTACCGCACGCAGCTACGCGACGCCAAGGGGCTTATCACCTCGTACCGCTCCGAACCTTCGTGTTCTCCCACGAAGGCGTACCTGCGAGGCAACGAAGCGTGCAAGCTGGCGCTGGAGAATTTGCCCGACGAGGTTTACGAGACCGAGTGGGACATGATCATGATCGACGCGCCGAAGGGGTATTTCGCGGAGGCGCCGGGGAGGATGGCGGCGGTGTTCTCCGCCGCGGTGATGGCGAGGAACAGGAAGGAATCCGGTGTGACGCACGTGTTTTTGCATGACGTGGATCGGAAGGTGGAGAAGGTGTACGCCGAAGAGTTTCTCTGTAAAAAGAACTTGGTCAAGGGTGTTGGAAGGCTTTGGCACTTCGAGATACCTCCTTCTAACGACACACGTGCTTCTCGTTTCTGCTAG
Predicted protein sequences of Glyma11g37020
>Glyma11g37020.1   sequence type=predicted peptide   gene model=Glyma11g37020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNRYLVPERRWFVGLAVVGLIGAVLFLSNAIRTSETSYVCPGALGIRSKTRTEFSYDASPIQLRAIMHYATSRVVPQQSVSEIKISLDVIKSLGRPINFLVFGLGHDSLMWASFNPGGTTVFLEEDPKWVHSILKDAPGLRAHTVRYRTQLRDAKGLITSYRSEPSCSPTKAYLRGNEACKLALENLPDEVYETEWDMIMIDAPKGYFAEAPGRMAAVFSAAVMARNRKESGVTHVFLHDVDRKVEKVYAEEFLCKKNLVKGVGRLWHFEIPPSNDTRASRFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo