Glyma11g36950 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g36950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g36950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g36950

Feature Type:	gene_model
Chromosome:	Gm11
Start:	38222903
stop:	38224136
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g36950

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27970	AT	Annotation by Michelle Graham. TAIR10: nuclear transport factor 2B \| chr1:9746921-9747787 FORWARD LENGTH=126	SoyBase	E_val: 1.00E-72	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0006913	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005635	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0008536	GO-mf	Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
KOG2104	KOG	Nuclear transport factor 2	JGI		ISS
PTHR12612	Panther	NUCLEAR TRANSPORT FACTOR 2	JGI		ISS
PF02136	PFAM	Nuclear transport factor 2 (NTF2) domain	JGI		ISS
UniRef100_G7JBF4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transport factor n=1 Tax=Medicago truncatula RepID=G7JBF4_MEDTR	SoyBase	E_val: 2.00E-73	ISS
UniRef100_I1LN65	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN65_SOYBN	SoyBase	E_val: 9.00E-86	ISS

Expression Patterns of Glyma11g36950

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g36950 not represented in the dataset	Glyma11g36950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g36950

Paralog	Evidence	Comments
Glyma18g00861	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g36950 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g251700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g36950

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma11g36950

Limit To All Plant Sequences

>Glyma11g36950.2   sequence type=transcript   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGAAATTGAAAATTGGAGTGAATTGTATAACAAATTTTAATTAGATTAGATTAGGTGGGTGGGTTTAAAAAGCCCTATTGGAGAGAGGAGAGGGTGGTGGTGTGCGTGAGAGTGAAGCGAGAAGCGAGAAGCGACATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACTCCACCTTCGACACCAACCGCAACAATCTCGCCAATCTCTACCAGGAAGGTTCCATGCTCTCTTTCGAGGGTCAGAAGATCCAGGGCTCCCACAACATCGTCGCCAAACTCACCTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCTCAGCCCTCAGGCGTCAACGCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACGCCCTCAAGTTCAGCCAAGGAAGCTATTATGTGTTGAATGACATATTCCGGTTGAACTATGCGTGAAAGATAGACCTCTGAGTATGTTGACATTTGCCTACAGCTGTTTTGCTTCAGACATTTGCATTTGAGAATTAACGAGTTCATTTTGGTTCGTGTTGAACGCATAATTGTGCCTCTTCTGTTTTAGAATTTCCTGTTGCGATTGGTCAAAACGCTTTCATGGATAAATTGTTAAAGATTGATGCAAATTGGAGGGTGAAAACTTTTATTTTTTTATATATTAGCTTCCAACATCCCGTGCTAATTTTACCTCTTAAAGTTTGTTTATGCATATCTTGTATTCGATTTTATGGCTAAATTTAAATGTTGATTTTCTCTC

>Glyma11g36950.3   sequence type=transcript   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGAAATTGAAAATTGGAGTGAATTGTATAACAAATTTTAATTAGATTAGATTAGGTGGGTGGGTTTAAAAAGCCCTATTGGAGAGAGGAGAGGGTGGTGGTGTGCGTGAGAGTGAAGCGAGAAGCGAGAAGCGACATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACTCCACCTTCGACACCAACCGCAACAATCTCGCCAATCTCTACCAGGAAGGTTCCATGCTCTCTTTCGAGGGTCAGAAGATCCAGGGCTCCCACAACATCGTCGCCAAACTCACCTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCTCAGCCCTCAGGCGTCAACGCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACGCCCTCAAGTTCAGCCAAGTATATGTTCCATTTGATACCAACACCACAGGGAAGCTATTATGTGTTGAATGACATATTCCGGTTGAACTATGCGTGAAAGATAGACCTCTGAGTATGTTGACATTTGCCTACAGCTGTTTTGCTTCAGACATTTGCATTTGAGAATTAACGAGTTCATTTTGGTTCGTGTTGAACGCATAATTGTGCCTCTTCTGTTTTAGAATTTCCTGTTGCGATTGGTCAAAACGCTTTCATGGATAAATTGTTAAAGATTGATGCAAATTGGAGGGTGAAAACTTTTATTTTTTTATATATTAGCTTCCAACATCCCGTGCTAATTTTACCTCTTAAAGTTTGTTTATGCATATCTTGTATTCGATTTTATGGCTAAATTTAAATGTTGATTTTCTCTC

Coding sequences of Glyma11g36950

Limit To All Plant Sequences

>Glyma11g36950.1   sequence type=CDS   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACTCCACCTTCGACACCAACCGCAACAATCTCGCCAATCTCTACCAGGAAGGTTCCATGCTCTCTTTCGAGGGTCAGAAGATCCAGGGCTCCCACAACATCGTCGCCAAACTCACCTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCTCAGCCCTCAGGCGTCAACGCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACGCCCTCAAGTTCAGCCAAATGTTCCATTTGATACCAACACCACAGGGAAGCTATTATGTGTTGAATGACATATTCCGGTTGAACTATGCGTGA

>Glyma11g36950.2   sequence type=CDS   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACTCCACCTTCGACACCAACCGCAACAATCTCGCCAATCTCTACCAGGAAGGTTCCATGCTCTCTTTCGAGGGTCAGAAGATCCAGGGCTCCCACAACATCGTCGCCAAACTCACCTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCTCAGCCCTCAGGCGTCAACGCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACGCCCTCAAGTTCAGCCAAGGAAGCTATTATGTGTTGAATGACATATTCCGGTTGAACTATGCGTGA

>Glyma11g36950.3   sequence type=CDS   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAGACGCGTTGGCAAAGGCATTCGTGGAGCACTACTACTCCACCTTCGACACCAACCGCAACAATCTCGCCAATCTCTACCAGGAAGGTTCCATGCTCTCTTTCGAGGGTCAGAAGATCCAGGGCTCCCACAACATCGTCGCCAAACTCACCTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCTCAGCCCTCAGGCGTCAACGCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACGCCCTCAAGTTCAGCCAAGTATATGTTCCATTTGATACCAACACCACAGGGAAGCTATTATGTGTTGAATGA

Predicted protein sequences of Glyma11g36950

Limit To All Plant Sequences

>Glyma11g36950.1   sequence type=predicted peptide   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPDALAKAFVEHYYSTFDTNRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFQQCQHSITTVDSQPSGVNAAMLVFVSGNLQLAGEQHALKFSQMFHLIPTPQGSYYVLNDIFRLNYA*

>Glyma11g36950.2   sequence type=predicted peptide   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPDALAKAFVEHYYSTFDTNRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFQQCQHSITTVDSQPSGVNAAMLVFVSGNLQLAGEQHALKFSQGSYYVLNDIFRLNYA*

>Glyma11g36950.3   sequence type=predicted peptide   gene model=Glyma11g36950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPDALAKAFVEHYYSTFDTNRNNLANLYQEGSMLSFEGQKIQGSHNIVAKLTSLPFQQCQHSITTVDSQPSGVNAAMLVFVSGNLQLAGEQHALKFSQVYVPFDTNTTGKLLCVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain