SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g36940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g36940): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g36940

Feature Type:gene_model
Chromosome:Gm11
Start:38220973
stop:38222747
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27300AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 54 Blast hits to 54 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 11; Fungi - 6; Plants - 34; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink). | chr1:9483324-9484194 FORWARD LENGTH=200 SoyBaseE_val: 2.00E-13ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_C6SZ09UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ09_SOYBN SoyBaseE_val: 1.00E-73ISS
UniRef100_Q9FZK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: F17L21.9 n=1 Tax=Arabidopsis thaliana RepID=Q9FZK5_ARATH SoyBaseE_val: 9.00E-11ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g36940 not represented in the dataset

Glyma11g36940 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g00850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g251800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g36940.2   sequence type=CDS   gene model=Glyma11g36940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACAAGATCGAAGACTTGAGCTCATCGACCACGCAATTCAGGTCCAAGGTTCCCTCCATAACAATGATGCTCAATACCAAAATGCTCTTTCCCACCTTTTCTCTGTCTCTCAGTTGAAAATGTTGAAAGGAGAAGAGATACTTGAGCAATTCGAGGCTTCTAGTTCTTCTGAGCCTGTGGCTTCTTTAACTCAGGAAACAGAAAGTGAAAAGGAGAATGGAAGGGAAGGTAAGGGAAGTAAGAATGATGAGATAATCAAAGAGCTGAAGAAGGTGAAGAGGCAGAACTTTGTGACTCATTGTCTTCTTTCGGTGATGATTGTCCTCAATGTGGCTTGGCAACTATCAGAGGTTTCTCTTATTTTGAAAGTCAAAGATGGACTAAGCCACTCTTTTAGATCCAAGAACCTGATGACAAAGAACACCCATCTGAATCTCCATCCCTTCCTTCCATGA

>Glyma11g36940.2   sequence type=predicted peptide   gene model=Glyma11g36940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQDRRLELIDHAIQVQGSLHNNDAQYQNALSHLFSVSQLKMLKGEEILEQFEASSSSEPVASLTQETESEKENGREGKGSKNDEIIKELKKVKRQNFVTHCLLSVMIVLNVAWQLSEVSLILKVKDGLSHSFRSKNLMTKNTHLNLHPFLP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo