Report for Sequence Feature Glyma11g36910
Feature Type: gene_model
Chromosome: Gm11
Start: 38205220
stop: 38206454
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g36910
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G48660 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF 3339) | chr3:18029659-18030133 FORWARD LENGTH=89
SoyBase E_val: 2.00E-34 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF11820 PFAM
Protein of unknown function (DUF3339)
JGI ISS
UniRef100_I1LN61 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN61_SOYBN
SoyBase E_val: 3.00E-39 ISS
UniRef100_Q2R3Y3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2R3Y3_ORYSJ
SoyBase E_val: 1.00E-26 ISS
Expression Patterns of Glyma11g36910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma11g36910
Paralog Evidence Comments
Glyma18g00830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma11g36910 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g252100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g36910
Coding sequences of Glyma11g36910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g36910.1 sequence type=CDS gene model=Glyma11g36910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGATTGGGGTCCAGTGGTGATAGCAGTGGTGCTGTTTGTGTTGCTAAGCCCTGGTCTTGTGTTTCAATTGCCAGGGAAGAGCAGAGTGGTGGAGTTTGGGAACATGCAAACCAGTGCAGTGTCTATCTTGGTCCACACAATCATCTTCTTTGGTCTCATTACCATCTTTCTTGTTGCTATTGGTGTGCATATCTACACTGGCTAG
Predicted protein sequences of Glyma11g36910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g36910.1 sequence type=predicted peptide gene model=Glyma11g36910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADWGPVVIAVVLFVLLSPGLVFQLPGKSRVVEFGNMQTSAVSILVHTIIFFGLITIFLVAIGVHIYTG*