SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g36830

Feature Type:gene_model
Chromosome:Gm11
Start:38150176
stop:38154290
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g36830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23700AT Annotation by Michelle Graham. TAIR10: Nucleic acid-binding proteins superfamily | chr3:8531689-8533742 REVERSE LENGTH=392 SoyBaseE_val: 3.00E-144ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR10287Panther RIBOSOMAL PROTEIN S1/PRE-RRNA PROCESSING PROTEIN RRP5 JGI ISS
PF00575PFAM S1 RNA binding domain JGI ISS
UniRef100_G7JBD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Polyribonucleotide nucleotidyltransferase n=1 Tax=Medicago truncatula RepID=G7JBD3_MEDTR SoyBaseE_val: 1.00E-174ISS
UniRef100_I1LN48UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN48_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma11g36830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g36830
ParalogEvidenceComments
Glyma18g00740 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g36830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g252900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g36830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g36830
>Glyma11g36830.1   sequence type=CDS   gene model=Glyma11g36830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCATATTCTCTGCAAGCTTGGGCTCCTTCACTTCCATCTCCTTCCTCTCAACTTCACAATCACAATCACAATCACACCTTTCTCCTTTCAAGTTAACTGTGAAGACACCTTGGCAATGGCAGCATCATCACTATCTCACTTCTAAAGTGTTGGTCTCTGCCTCTGGCAACACCCAAATTCCTAATACTGAACTTCTTCAACGCCCTACTCCTCCAGACCCTCTCGATGACGTTCGTCAGGCTCGGAGATCGTCAGATTGGAAGGCTGCAAAGACATATCAAGATAGTAAACTCATCTATAATGGTAGAGTGGAAGGTTTTAATTCTGGAGGCCTGCTGGTTCGGTTTTATTCTATTATGGGCTTTCTCCCATTCCCCCAATTGAGTCCAGTGCATGCTTCTAAAGAACCAGAGAAATCTATACAAGAAATTGCACAAGGCTTAATTGGTTCAATCATGTCGGTGAAGGTAATTCTAGCAGATGAGGATAACAAGAAATTGATCTTCTCTGAAAAGGAAGCTGCCTGGTCCAAATTTTCAAAACAGGTTAATGTAGGGGACATTTTTGAAGTAAGAGTTGGTTATGTTGAGGACTATGGTGCTTTTGTTCATTTGCGCTTCCCTGACGGTCTTTATCGCCTTACTGGACTAATACACGTGTCAGAAGTGTCATGGGATCTAATTCAGGATGTCAGAGATATCTTAAAAGTGGGCGATGAAGTGAGGGTCAAAGTTGTCGGTATTGATTGGGGAAAATCAAGGATTAACCTATCAATTAGACAGCTAGAAGAAGATCCACTCTTAGAAACTCTGGACAAAGTAATACCTCAGGATGGTTCAGCTGATCCTGATTCCATGAGCGGTGGTGATAGCGGTAGCATTGAGCCTCTTCCAGGACTTGAAACAATCCTTGAAGAGCTGCTACAGGAAGATGGAATATATGACGTAAGAATCAGCCGTCAAGGGTTTGAAAAACGAGTGGTCTCGCAGGACTTGCAGCTTTGGCTTTGTAATGCACCTCCCACGAACCAAAGGTTTACTCTTCTTGCTCGGGCTGGAAGACAGGTGCAGGAGATACACCTGACTACATCCCTTGATCAGGAAGGTATCAAGAAGGCATTACAACGAGTACTGGAGCGTGTCCCCTGA
Predicted protein sequences of Glyma11g36830
>Glyma11g36830.1   sequence type=predicted peptide   gene model=Glyma11g36830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPIFSASLGSFTSISFLSTSQSQSQSHLSPFKLTVKTPWQWQHHHYLTSKVLVSASGNTQIPNTELLQRPTPPDPLDDVRQARRSSDWKAAKTYQDSKLIYNGRVEGFNSGGLLVRFYSIMGFLPFPQLSPVHASKEPEKSIQEIAQGLIGSIMSVKVILADEDNKKLIFSEKEAAWSKFSKQVNVGDIFEVRVGYVEDYGAFVHLRFPDGLYRLTGLIHVSEVSWDLIQDVRDILKVGDEVRVKVVGIDWGKSRINLSIRQLEEDPLLETLDKVIPQDGSADPDSMSGGDSGSIEPLPGLETILEELLQEDGIYDVRISRQGFEKRVVSQDLQLWLCNAPPTNQRFTLLARAGRQVQEIHLTTSLDQEGIKKALQRVLERVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo