Glyma11g36420 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g36420

Feature Type:	gene_model
Chromosome:	Gm11
Start:	37917051
stop:	37918774
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g36420

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17230	AT	Annotation by Michelle Graham. TAIR10: PHYTOENE SYNTHASE \| chr5:5659839-5662087 REVERSE LENGTH=422	SoyBase	E_val: 2.00E-93	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0016117	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
GO:0016765	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups	SoyBase	N/A	ISS
GO:0016767	GO-mf	Annotation by Michelle Graham. GO Molecular Function: geranylgeranyl-diphosphate geranylgeranyltransferase activity	SoyBase	N/A	ISS
GO:0046905	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phytoene synthase activity	SoyBase	N/A	ISS
PF00494	PFAM	Squalene/phytoene synthase	JGI		ISS
UniRef100_G7JA42	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase n=1 Tax=Medicago truncatula RepID=G7JA42_MEDTR	SoyBase	E_val: 1.00E-137	ISS
UniRef100_I1LN11	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN11_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma11g36420

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g36420

Paralog	Evidence	Comments
Glyma18g00350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g36420 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g256400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g36420

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g36420

Limit To All Plant Sequences

>Glyma11g36420.2   sequence type=CDS   gene model=Glyma11g36420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTTATCATTTTGTTCACTGATGACAGCAAAGCCTTGTTCCATGATCAATACTGGGAGCAATAGGAAACCATGTTGTGGTCGTAGAAGATTTGGTGTTATAATTAGGTCGGAAGTAAATGTGGCTCCCAAACAAAGAGGAATTCTCCGATTGTCAAAACAAGGAGTTCCTCTTGCTGTACAAGAGCTTAAGCCACTGTTTAAGCCCATTTTTCTTAATGATGCCTATGAAATGTGCAGAAATATTTGCGCGGAATATGCCAAGACCTTTTATCTAGAAGAAAGACAGAAAGCTATATGTGCAATTTATGTTTGGTGCAGGAGGATGGATGGACTTGTTGATGATCCTAACGCGGTGTATATGAGCTCTGCTATTCTTGATAGGTGGGAAGATAGATTGCACGACATTTTTAATGGACAACCCTATGATATGCTTGATGCTGCTCTTACTGATATCGTCTCCAAGGACATGATACAAAACATGAGAATGGATACGAGGAAAGCCCAATACAACAATTTTCAAGAGTTATATCTTTACTGCTACTATGTGGCGGGAACTGTGGGCTTAATGACTGTTCCGATAATGGGCATTGCCCAGGAGTCTGTCATCCCAATTCAAAGTGTATATGATGTTGCACTATATCTGGGTGTAGGAAATCAACTCACAAACATTCTTAGAGATGTGGGGGAGGAGACAAGATTCTACTTCAACCGGGCAGAAGAAGGAGTTTCTCAGCTCCAAAAAGCCAGTCGTTGGCCAGTTTGGTCATCATTAATATTGTATCGTAAGATCTTGGATGCAATTGAAGACAACGATTACGACAATTTGACTAAACGAGCCTGTGTGGGATGTGCCAAGAAATTTTTGACATTGCCCCTAACTTACACTAGATCTCTCTCAAATCCCAAAATGAAACTTGGTCCTTCTTTAACGAGGCCTATCTAG

Predicted protein sequences of Glyma11g36420

Limit To All Plant Sequences

>Glyma11g36420.2   sequence type=predicted peptide   gene model=Glyma11g36420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLSFCSLMTAKPCSMINTGSNRKPCCGRRRFGVIIRSEVNVAPKQRGILRLSKQGVPLAVQELKPLFKPIFLNDAYEMCRNICAEYAKTFYLEERQKAICAIYVWCRRMDGLVDDPNAVYMSSAILDRWEDRLHDIFNGQPYDMLDAALTDIVSKDMIQNMRMDTRKAQYNNFQELYLYCYYVAGTVGLMTVPIMGIAQESVIPIQSVYDVALYLGVGNQLTNILRDVGEETRFYFNRAEEGVSQLQKASRWPVWSSLILYRKILDAIEDNDYDNLTKRACVGCAKKFLTLPLTYTRSLSNPKMKLGPSLTRPI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain