Glyma11g36090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g36090

Feature Type:	gene_model
Chromosome:	Gm11
Start:	37624958
stop:	37628238
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g36090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25630	AT	Annotation by Michelle Graham. TAIR10: fibrillarin 2 \| chr4:13074239-13076205 FORWARD LENGTH=320	SoyBase	E_val: 2.00E-165	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006164	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0008033	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA processing	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0016592	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mediator complex	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
GO:0030515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: snoRNA binding	SoyBase	N/A	ISS
KOG1596	KOG	Fibrillarin and related nucleolar RNA-binding proteins	JGI		ISS
PTHR10335	Panther	FIBRILLARIN	JGI		ISS
PF01269	PFAM	Fibrillarin	JGI		ISS
UniRef100_G7IDD7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Fibrillarin n=1 Tax=Medicago truncatula RepID=G7IDD7_MEDTR	SoyBase	E_val: 3.00E-171	ISS
UniRef100_I1LMZ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LMZ2_SOYBN	SoyBase	E_val: 9.00E-180	ISS

Expression Patterns of Glyma11g36090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g36090

Paralog	Evidence	Comments
Glyma18g02340	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g36090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g237200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g36090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g36090

Limit To All Plant Sequences

>Glyma11g36090.2   sequence type=CDS   gene model=Glyma11g36090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCTCCCAGAGGTCGTGGTGGTTTTGGTGGTGGTGGTGGTGGTGGGTTCAGGGGTGGTGGTAGGGGTGACAGAGGCAGAGGAAGGGGCGGTGGAGGAAGAGGAGGAGACAGAGGTACACCCTTCAAAGCTAGAGGCGGTGGTAGAGGTGGTGGAGGCCGTGGAGGAGGCAGGGGTGGTGGCCGTGGCGGTGGCAGAGGTGGAATGAAGGGTGGTAGCAAGGTTGTTGTTCAGCCCCATAGACATGACGGTATTTTCATTGCCAAGGGTAAAGAAGATGCTCTCGTTACCAAGAATCTTGTTCCCGGTGAAGCTGTTTACAATGAGAAAAGGATTACTGTTCAGAATGAAGATGGTACCAAAGAGGAGTACAGAGTTTGGAATCCTTTCCGATCCAAGTTGGCTGCTGCCATCCTTGGTGGAGTTGACAACATATGGATTAAACCCGGAGCCAGAGTCCTTTACCTTGGAGCTGCTTCTGGGACCACTGTTTCTCATGTGTCGGACGTTGTTGGCCCTACTGGAGTTGTCTATGCAGTAGAATTTTCCCATAGAAGTGGACGTGACTTGGTCAATATGGCAAAGAAAAGAACTAACGTTATACCCATTATTGAAGATGCTAGACATCCAGCTAAATACAGGATGTTGGTTGGAATGGTTGATGTCATATTTTCTGATGTTGCTCAACCTGATCAGGCTAGGATTTTGGGGCTGAATGCTTCATATTATCTGAAAACAGGAGGTCATTTTGTTATTTCAATCAAGGCTAACTGCATAGACTCCACAGTCCCTGCTGAGGCAGTGTTTGAAAGCGAAGTGAACAAGTTGAAGGCAGATCAATTCAAACCATTCGAGCAAGTCACCCTTGAACCATTTGAGAGGGACCATGCCTGTGTGGTTGGTGGATACAGAATGCCCAAGAAGAAAAAAGATGCTGCTGAGTAG

Predicted protein sequences of Glyma11g36090

Limit To All Plant Sequences

>Glyma11g36090.2   sequence type=predicted peptide   gene model=Glyma11g36090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPPRGRGGFGGGGGGGFRGGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGGGRGGGRGGGRGGGRGGMKGGSKVVVQPHRHDGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQNEDGTKEEYRVWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDVVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYYLKTGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRMPKKKKDAAE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain