SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g35580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g35580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g35580

Feature Type:gene_model
Chromosome:Gm11
Start:37227893
stop:37229107
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58530AT Annotation by Michelle Graham. TAIR10: Glutaredoxin family protein | chr5:23660428-23661249 FORWARD LENGTH=273 SoyBaseE_val: 1.00E-50ISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
KOG2824 KOG Glutaredoxin-related protein JGI ISS
PTHR10168Panther GLUTAREDOXIN JGI ISS
PTHR10168:SF44Panther GLUTAREDOXIN DOMAIN-CONTAINING CYSTEINE-RICH PROTE JGI ISS
PF00462PFAM Glutaredoxin JGI ISS
UniRef100_G7JBX5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutaredoxin domain-containing cysteine-rich protein n=1 Tax=Medicago truncatula RepID=G7JBX5_MEDTR SoyBaseE_val: 3.00E-82ISS
UniRef100_UPI000233CFA0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233CFA0 related cluster n=1 Tax=unknown RepID=UPI000233CFA0 SoyBaseE_val: 1.00E-162ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g35580 not represented in the dataset

Glyma11g35580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g02840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g232300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g35580.1   sequence type=CDS   gene model=Glyma11g35580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCTACCATGGCGTATCCGAACCACAGCTTCGCGTTCAAACCGATCCCAATCCTGCACCATCTCCTGCTCTTCCTTCAAAGACATCCAATCCATACTCGAATCCGAACCTGAACCTCCCTCTCTATTCCGCCGCCTAATCGTCTCTCCCTCCCTCATCCGCTCCTTTAGCAGCCCCCGCGCCGCCTCCTCCGCCGTCCAACCGCCTCCGGACTCCGACCGTACCGCCGTCGTCGTCTACTACACTAGCCTCCGCGTCGTCCGCCGCACCTTCGACGACTGCCGCGCCGTCCGATCTATCCTCCGCGGCTTCGCCGTCGCGATCGACGAGCGCGACGTCAGCGTCGACGAGCGCTTCCGCGAGGAACTGCAGCGGATCCTCGTCCGCCGCAGCGTGCCGCTGCCGAGCGTCTTCGTCGCCGGCGTGTACATCGGCGGTGCCGACGAGGTGAGGAAGCTCTACGAGAACGGCGAGTTGCACGAGTTGATCAGACGGTTGCCGAAGTCACAGAGGAACATGTGTGATTTGTGCGGAGGGCTGAGATTCGTGGTCTGCGACGAGTGCGATGGAAGCCACAAAGTGTTCGGAGAGAAGAGTGGCGGATTCAGGAGCTGTTCGTCTTGCAATTCCAACGGTTTGATTAGGTGTCCTGCATGTTTCGTGGTGAAGCCGCGACACACCAAATAA

>Glyma11g35580.1   sequence type=predicted peptide   gene model=Glyma11g35580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWLPWRIRTTASRSNRSQSCTISCSSFKDIQSILESEPEPPSLFRRLIVSPSLIRSFSSPRAASSAVQPPPDSDRTAVVVYYTSLRVVRRTFDDCRAVRSILRGFAVAIDERDVSVDERFREELQRILVRRSVPLPSVFVAGVYIGGADEVRKLYENGELHELIRRLPKSQRNMCDLCGGLRFVVCDECDGSHKVFGEKSGGFRSCSSCNSNGLIRCPACFVVKPRHTK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo