SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g35280

Feature Type:gene_model
Chromosome:Gm11
Start:36969574
stop:36973448
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g35280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55920AT Annotation by Michelle Graham. TAIR10: Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein | chr3:20743529-20745049 REVERSE LENGTH=228 SoyBaseE_val: 1.00E-106ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
KOG0880 KOG Peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR11071Panther CYCLOPHILIN JGI ISS
PTHR11071:SF121Panther JGI ISS
PF00160PFAM Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD JGI ISS
UniRef100_C6TD81UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6TD81_SOYBN SoyBaseE_val: 7.00E-173ISS
UniRef100_C6TD81UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6TD81_SOYBN SoyBaseE_val: 7.00E-173ISS

Expression Patterns of Glyma11g35280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g35280
ParalogEvidenceComments
Glyma18g03120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g35280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g229800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g35280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g35280
>Glyma11g35280.1   sequence type=CDS   gene model=Glyma11g35280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCTAGAGGAACTGGAACGCTGATTTTGGTTTGTCTCTTATGGCTTTTCTTCCTATGCGCCACCATAGCTTTCTTGCAGCTCAACTTCGTAGACAAAGGAACCACCAACAACAACCCTTCCTCTCGCAGTAGTAACTTCATCGCAACTCAACAGCATAGCGCTGATACCCCTTTGGAACAGGATTTGGAGGGTGTCACCCACAAGGTGTATTTTGATATTCAGATCCATGGCAAATTAGCGGGTCGCATAGTCATGGGCCTTTATGGGAACACAGTACCGAAAACTGCAGAAAACTTTCGAGCGCTTTGTACAGGAGAGAAAGGAGTGGGAAGAAGTGGGAAGTCTCTTCATTATAAAGGGAGCACATTCCATAGGATTATACCGAGCTTTATGGTCCAAGGGGGTGATTTCACCCGTGGTGATGGAAGAGGTGGAGAATCAATCTATGGTGATAAGTTTGCTGATGAAAACTTTAAGCTGAAGCATACCGGACCGGGATACTTATCCATGGCAAATTCTGGGGAAGACACCAATGGCTCCCAGTTCTTCATTACAACAGTTAAAACCAGCTGGCTGGATGGACGCCATGTCGTATTTGGCAAGGTACTTTCCGGTATGGATGTTTTGTACAAGATTGAAGCAGAAGGAAGTGAAAGCGGCTCGCCAAAGAACAAGGTTGTCATATTAGACAGTGGAGAATTAACTTCATGA
Predicted protein sequences of Glyma11g35280
>Glyma11g35280.1   sequence type=predicted peptide   gene model=Glyma11g35280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASRGTGTLILVCLLWLFFLCATIAFLQLNFVDKGTTNNNPSSRSSNFIATQQHSADTPLEQDLEGVTHKVYFDIQIHGKLAGRIVMGLYGNTVPKTAENFRALCTGEKGVGRSGKSLHYKGSTFHRIIPSFMVQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGYLSMANSGEDTNGSQFFITTVKTSWLDGRHVVFGKVLSGMDVLYKIEAEGSESGSPKNKVVILDSGELTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo