SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g35270

Feature Type:gene_model
Chromosome:Gm11
Start:36968443
stop:36969563
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40080AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1313) | chr2:16734545-16734880 REVERSE LENGTH=111 SoyBaseE_val: 2.00E-34ISS
GO:0009648GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism SoyBaseN/AISS
GO:0009649GO-bp Annotation by Michelle Graham. GO Biological Process: entrainment of circadian clock SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010017GO-bp Annotation by Michelle Graham. GO Biological Process: red or far-red light signaling pathway SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0042753GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of circadian rhythm SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
PF07011PFAM Protein of unknown function (DUF1313) JGI ISS
UniRef100_I1LMR6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LMR6_SOYBN SoyBaseE_val: 3.00E-93ISS
UniRef100_Q52ZI3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early flowering 4 n=1 Tax=Pisum sativum RepID=Q52ZI3_PEA SoyBaseE_val: 6.00E-50ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g03130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g229700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g35270.1   sequence type=CDS   gene model=Glyma11g35270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTCATCCTCCTCCGCCGCAGAGTCCACCATGGAAGACCGCCGCTCGAAGAAGCACCACCGCCGTCACCGCCACCACCCCGCCACGACGACAACAACCTTGAGCACGACGACCGGGGAGTCGGACGGGGAGGTGGAGGAGGCGGAGGACGGCGACCCGGAGGCGTGGGTCACCCTGAACAAGGGGTTCCGGCAGGTGCAGTCGGTGCTGGACCGGAACCGGCTACTGATTCAGCAGGTGAACGAGAACCAGCAGTCTCGGATGCACGACAACATGGTAAAAAACGTGTCCCTCATTCAGGAACTCAACGGCAACATCTCCAAGGTTGTCTCTCTCTACTCTGATCTCAACACCAATTTCTCCAACGTTTGCCAACAACGCTCCAAAAACTCCTCCAAATAA

>Glyma11g35270.1   sequence type=predicted peptide   gene model=Glyma11g35270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNSSSSAAESTMEDRRSKKHHRRHRHHPATTTTTLSTTTGESDGEVEEAEDGDPEAWVTLNKGFRQVQSVLDRNRLLIQQVNENQQSRMHDNMVKNVSLIQELNGNISKVVSLYSDLNTNFSNVCQQRSKNSSK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo