SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g35130

Feature Type:gene_model
Chromosome:Gm11
Start:36855887
stop:36859844
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g35130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40100AT Annotation by Michelle Graham. TAIR10: light harvesting complex photosystem II | chr2:16745884-16747190 FORWARD LENGTH=276 SoyBaseE_val: 8.00E-139ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_G7JB75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein CP29.3 n=1 Tax=Medicago truncatula RepID=G7JB75_MEDTR SoyBaseE_val: 6.00E-147ISS
UniRef100_I1LMQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LMQ5_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma11g35130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g35130
ParalogEvidenceComments
Glyma18g03220 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g35130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g228800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g35130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g35130
>Glyma11g35130.1   sequence type=CDS   gene model=Glyma11g35130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACTGCCACCGCCGCCGCCGCCACGTCATACTTTTTCGGCACCCGTCTCAACAACGTTAACACGACAACCTTAAACAACGGAAGATTCCACGCGCTCTTGAACTTCGGCAAAAAGAAGACGGCGCCGCAGCCGCCGCCGAAGAAAAAGGAAGTGAAAGTGAAACCCTCCGGAGACCGGCTGGTGTGGTTCCCGAATGCGGAGCCGCCGGAGTGGCTCGATGGAAGCATGATCGGCGACCGCGGGTTCGACCCGTTCGGGTTCGCGAAGCCCGCGGAGTACCTGCAGTTCGACCTGGACTCGCTGGACCAGAACCTCGCGAAGAACATCGCCGGCGATGTGATCGGAACCAGGGTGGAGGTCGCCGAGGTTAAGCCGACGCCGTTTCAGCCCTACTCGGAGGTTTTCGGGATTCAGAGGTTCCGTGAGTGCGAACTCATTCATGGAAGGTGGGCAATGCTGGGTTCTCTCGGTGCTTTGGCCGTTGAGGCTCTCACGGGAGTCGCATGGCAAGACGCCGGAAAGGTAGAGCTAGTGGAAGGATCATCTTACCTGGGACTTCCTCTTCCATTTTCATTGACCACACTGATCTGGATTGAGGTGATAGTGATAGGGTACATAGAGTTTCAAAGAAATGCAGAACTTGACCCAGAGAAAAGGTTGTACCCAGGTGGCAGGTTCTTTGATCCTCTGGGTTTGGCCAACGACCCTGAAGAAAAAGCCAGACTTCAACTTGCTGAGATCAAGCATTCTCGCTTAGCCATGGTGGTCTTCCTCATCTTTGCAATTCAAGCTGCTGTGACAGGAAAAGGCCCAATCAGTTTTCTTGCTACCTTCAACAAGTGA
Predicted protein sequences of Glyma11g35130
>Glyma11g35130.1   sequence type=predicted peptide   gene model=Glyma11g35130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATATAAAATSYFFGTRLNNVNTTTLNNGRFHALLNFGKKKTAPQPPPKKKEVKVKPSGDRLVWFPNAEPPEWLDGSMIGDRGFDPFGFAKPAEYLQFDLDSLDQNLAKNIAGDVIGTRVEVAEVKPTPFQPYSEVFGIQRFRECELIHGRWAMLGSLGALAVEALTGVAWQDAGKVELVEGSSYLGLPLPFSLTTLIWIEVIVIGYIEFQRNAELDPEKRLYPGGRFFDPLGLANDPEEKARLQLAEIKHSRLAMVVFLIFAIQAAVTGKGPISFLATFNK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo