SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g34000

Feature Type:gene_model
Chromosome:Gm11
Start:35830512
stop:35832668
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g34000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55470AT Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein | chr3:20564356-20566092 FORWARD LENGTH=155 SoyBaseE_val: 6.00E-47ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1030 KOG Predicted Ca2+-dependent phospholipid-binding protein JGI ISS
PTHR10024Panther SYNAPTOTAGMIN JGI ISS
PF00168PFAM C2 domain JGI ISS
UniRef100_C6T2V8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2V8_SOYBN SoyBaseE_val: 2.00E-105ISS
UniRef100_D0R6I8UniRef Annotation by Michelle Graham. Most informative UniRef hit: C2 domain-containing protein n=1 Tax=Malus x domestica RepID=D0R6I8_MALDO SoyBaseE_val: 2.00E-60ISS

Expression Patterns of Glyma11g34000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g34000
ParalogEvidenceComments
Glyma18g04330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g34000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g219000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma11g34000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g34000
>Glyma11g34000.1   sequence type=CDS   gene model=Glyma11g34000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATTGGGTTCATGGAGGTGCAGCTTGTGAAAGCAAAGGAGTTGTGTGACACTGATTTCTTTGGTAGTATGGACCCGTATGTTGTGATACAATACAACGGCCAAGAGCAAAGGAGTAGTGTTGCTAAGGGACAGGGCAATAATCCGGTATGGAATGAGAAATTTGTGTTCAAGGTAGAATATCCTACACTGAGTAATTCATACAAGATTATCTTAAAAATCATGGACAAGGATCTTTTATCTGCAGATGACTTTGTTGGTCAAGCCATAGTCTATGTGGAAGATTTATTAGCCATAGGGGTAGAGGATGGTGCGGCTGAGCTACAACCTCTAAAGTACAGAGTAATTCGTGCAGATCAATCTTATTGTGGAGAAATTGATCTTGGTATAACTTTTAAGGTGGAAGAAGAGTTCAATGGAGAAGCTAAACGAGGATCGAAGGACAGTAAATAG
Predicted protein sequences of Glyma11g34000
>Glyma11g34000.1   sequence type=predicted peptide   gene model=Glyma11g34000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIGFMEVQLVKAKELCDTDFFGSMDPYVVIQYNGQEQRSSVAKGQGNNPVWNEKFVFKVEYPTLSNSYKIILKIMDKDLLSADDFVGQAIVYVEDLLAIGVEDGAAELQPLKYRVIRADQSYCGEIDLGITFKVEEEFNGEAKRGSKDSK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo