Glyma11g33590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g33590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g33590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g33590

Feature Type:	gene_model
Chromosome:	Gm11
Start:	35424092
stop:	35426358
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g33590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G01670	AT	Annotation by Michelle Graham. TAIR10: nudix hydrolase homolog 17 \| chr2:296889-297818 REVERSE LENGTH=182	SoyBase	E_val: 4.00E-76	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG2839	KOG	Diadenosine and diphosphoinositol polyphosphate phosphohydrolase	JGI		ISS
PTHR12629	Panther	DIPHOSPHOINOSITOL POLYPHOSPHATE PHOSPHOHYDROLASE	JGI		ISS
PF00293	PFAM	NUDIX domain	JGI		ISS
UniRef100_G7J9C3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nudix hydrolase n=1 Tax=Medicago truncatula RepID=G7J9C3_MEDTR	SoyBase	E_val: 8.00E-114	ISS
UniRef100_I1LMB6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LMB6_SOYBN	SoyBase	E_val: 1.00E-152	ISS

Expression Patterns of Glyma11g33590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g33590 not represented in the dataset	Glyma11g33590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g33590

Paralog	Evidence	Comments
Glyma18g04620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g33590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.11g215700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma11g33590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g33590

Limit To All Plant Sequences

>Glyma11g33590.1   sequence type=CDS   gene model=Glyma11g33590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGCTGTGGTTTCCCAAGAAAATGTTGCGGCATTGGTTTCTCGTACCGGTAGGGAGTTGCAACGTTATAGAAAAGGTCGTCGCCAAGTTGTGGGATGCATACCGTACAGATTTAAGATTGGGGAGAAGACTTCCTTGGATGTTGTTTCTGATGAATTGGAAGTTCTGGTTATTAGTTCCCAGAAAGGAAAAGGGATGCTATTTCCAAAGGGAGGCTGGGAATTAGACGAATCAAAAAAGGAGGCAGCTTTGAGAGAAACCATGGAGGAAGCTGGGGTGCGAGGCATTGTTGGGGGTAAATTGGGCAAATGGAGTTTCAAGAGCAAGACTCATGACACTTTCTATGAAGGCTACATGTTCCCTTTACTTGTTCAAGAACAATTGGAGTTCTGGCCAGAGCAAAACGTTCGTCAAAGAATATGGATGAGCGTCACAGAAGCAAGGGAAGTTTGTCAACACTGGTGGATGAAGGAAGCTCTAGACAGACTTGTAAATCGTCTCTCTGGTCAAAAACAACTTGGTCATTATCGTGATAATAAGCGAGTTCTTGGTTCTATGAACTGCAAAGGAGATGCCAAATCTGCTTCTGTAAATAGTGTAGCATCTTTGGAGGGTAGAGCTCAACTTTTTTGA

Predicted protein sequences of Glyma11g33590

Limit To All Plant Sequences

>Glyma11g33590.1   sequence type=predicted peptide   gene model=Glyma11g33590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAVVSQENVAALVSRTGRELQRYRKGRRQVVGCIPYRFKIGEKTSLDVVSDELEVLVISSQKGKGMLFPKGGWELDESKKEAALRETMEEAGVRGIVGGKLGKWSFKSKTHDTFYEGYMFPLLVQEQLEFWPEQNVRQRIWMSVTEAREVCQHWWMKEALDRLVNRLSGQKQLGHYRDNKRVLGSMNCKGDAKSASVNSVASLEGRAQLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain