Glyma11g32900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma11g32900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma11g32900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma11g32900

Feature Type:	gene_model
Chromosome:	Gm11
Start:	34637902
stop:	34638402
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma11g32900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02710	AT	Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein \| chr3:583184-585780 FORWARD LENGTH=529	SoyBase	E_val: 7.00E-71	ISS
GO:0008380	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing	SoyBase	N/A	ISS
GO:0042732	GO-bp	Annotation by Michelle Graham. GO Biological Process: D-xylose metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PTHR14978	Panther	BETA-CATENIN-LIKE PROTEIN 1 (NUCLEAR ASSOCIATED PROTEIN)	JGI		ISS
PF08216	PFAM	Eukaryotic domain of unknown function (DUF1716)	JGI		ISS
UniRef100_G7J7W2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Beta-catenin-like protein n=2 Tax=Medicago truncatula RepID=G7J7W2_MEDTR	SoyBase	E_val: 3.00E-84	ISS
UniRef100_UPI000233CB1C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233CB1C related cluster n=1 Tax=unknown RepID=UPI000233CB1C	SoyBase	E_val: 4.00E-108	ISS

Expression Patterns of Glyma11g32900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma11g32900 not represented in the dataset	Glyma11g32900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma11g32900

Paralog	Evidence	Comments
Glyma18g05210	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma11g32900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma11g32900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma11g32900

Limit To All Plant Sequences

>Glyma11g32900.1   sequence type=CDS   gene model=Glyma11g32900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAGTCGTCGACGTCGATCTCTCCCTCCTCGAAGCCATTGAGAAATCGCAGAGCGCCGTCGAAGCCCTCGACCTCCGAGCCCTAAAGAAGCACGTTCTCTCCTTCGAGCGTCGCCTGAAAGAAAACATCGAAGCGCGCCTCAAATACCCTAACCAACCGGACCGCTTCGCCGATTCCGAAGTCGAACTCCACGAAGAGCTTCAGAAGCTAAAGGTCCTCGCTAGCGCGCCAGAGTTCTACCCGGACCTCGTGAGCCTCAACGTTGTTCCCTCCATCGTCGACCTCCTCAACCACGACAACACCGACATCGCCATCGATGTCGTGCAATTGCTCCAGGACCTCACCAACGAGGACGTTCTGGACGACAACGACGACTCCGCTAGGGTTTTGGTCGACGCGCTTGTCGAGAATAGCGCACTCGAGCTCCTCGTGCAGAACCTGCACCGGTTGAACGACTCCGATCCCGACAAGAACGCCGCCGTGTACGGCACTCTCGCCACG

Predicted protein sequences of Glyma11g32900

Limit To All Plant Sequences

>Glyma11g32900.1   sequence type=predicted peptide   gene model=Glyma11g32900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KVVDVDLSLLEAIEKSQSAVEALDLRALKKHVLSFERRLKENIEARLKYPNQPDRFADSEVELHEELQKLKVLASAPEFYPDLVSLNVVPSIVDLLNHDNTDIAIDVVQLLQDLTNEDVLDDNDDSARVLVDALVENSALELLVQNLHRLNDSDPDKNAAVYGTLAT

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain