|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G11940 | AT | Annotation by Michelle Graham. TAIR10: ribosomal protein 5A | chr3:3778175-3779354 REVERSE LENGTH=207 | SoyBase | E_val: 8.00E-42 | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0015935 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit | SoyBase | N/A | ISS |
GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
PTHR11205 | Panther | RIBOSOMAL PROTEIN S7 | JGI | ISS | |
PTHR11205:SF1 | Panther | 40S RIBOSOMAL PROTEIN S5 | JGI | ISS | |
PF00177 | PFAM | Ribosomal protein S7p/S5e | JGI | ISS | |
UniRef100_B3TLN7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S5 n=1 Tax=Elaeis guineensis RepID=B3TLN7_ELAGV | SoyBase | E_val: 4.00E-40 | ISS |
UniRef100_I1LUE0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LUE0_SOYBN | SoyBase | E_val: 8.00E-49 | ISS |
Glyma11g32411 not represented in the dataset |
Glyma11g32411 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.11g206800 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g32411.1 sequence type=CDS gene model=Glyma11g32411 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCGACGAAGTTGTGGTTGTTCCAGATCCCACCCAGATCAATGTTACTGACATTTCACTGGCTGATTACGTTGAAGTTGCGGCATCCAAGCACGCCACATATGTTCCTCACACCACCGAAAAGTACTTGGTGAAGCAGTTCAGCAAGGTGCGGTGCCCCATTGTTGAGAGTCTCACGAACTCTCTCATGATGCACGGTAGAAACAATGGCAAGAAACTCATGGCTATTAGGATCATGAAGCATGCTATGGAGATTATTCATTTGTTGACTGACCACAACCCCATTTAG
>Glyma11g32411.1 sequence type=predicted peptide gene model=Glyma11g32411 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MADEVVVVPDPTQINVTDISLADYVEVAASKHATYVPHTTEKYLVKQFSKVRCPIVESLTNSLMMHGRNNGKKLMAIRIMKHAMEIIHLLTDHNPI*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||