Report for Sequence Feature Glyma11g30690
Feature Type: gene_model
Chromosome: Gm11
Start: 31667671
stop: 31668556
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma11g30690
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G48670 AT
Annotation by Michelle Graham. TAIR10: AGAMOUS-like 80 | chr5:19738825-19739790 REVERSE LENGTH=321
SoyBase E_val: 7.00E-25 ISS
GO:0009612 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus
SoyBase N/A ISS
GO:0019722 GO-bp
Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0043078 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: polar nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0046983 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity
SoyBase N/A ISS
PTHR11945 Panther
MADS BOX PROTEIN
JGI ISS
PTHR11945:SF69 Panther
AGL80/FEM111 (AGAMOUS-LIKE80), DNA BINDING / TRANS
JGI ISS
PF00319 PFAM
SRF-type transcription factor (DNA-binding and dimerisation domain)
JGI ISS
UniRef100_G7IND5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Agamous-like MADS-box protein AGL80 n=1 Tax=Medicago truncatula RepID=G7IND5_MEDTR
SoyBase E_val: 6.00E-30 ISS
UniRef100_I1LLX2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LLX2_SOYBN
SoyBase E_val: 8.00E-84 ISS
Expression Patterns of Glyma11g30690
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Gene model name correspondences to Glyma11g30690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.11g186400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma11g30690
Coding sequences of Glyma11g30690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma11g30690.1 sequence type=CDS gene model=Glyma11g30690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACTAGAAAAAAGGTGAAACTTACATTAATAACGAATGATGCTGCAAGGAGGGAAACATACAAGAAAAGGAAGAAACAAATGCTGAAGAAGGTTGAGGAACTCAACACCCTTTATGGAATTGAAGCATGTGCCATAGTTTATGGCCACAATGATCTAGATCGAGCCAGAGTTTTGGCCATCCCATTGGGGGAATGGGGAGTCCAAAGGGTGGTGGAAAAGCTCAGGATCATGCCTGAATTGGAAAGAAGCAAGAAGATGGTGAACCAAGCAGGTTTCATTGGACAAAGAATCCTGAAGGGTAACGAGCAAGTGATGAAGCTTATGAAGGACAATAGGGAAAAAGACCAAAGCCCTATTCTATCACTACTAAACACTACTAAAAAAAGGATTTTTTTACGACGATGGAACAGTACAATAAACAAGTTTACCACAAATAACCATATATGTTGA
Predicted protein sequences of Glyma11g30690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma11g30690.1 sequence type=predicted peptide gene model=Glyma11g30690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTRKKVKLTLITNDAARRETYKKRKKQMLKKVEELNTLYGIEACAIVYGHNDLDRARVLAIPLGEWGVQRVVEKLRIMPELERSKKMVNQAGFIGQRILKGNEQVMKLMKDNREKDQSPILSLLNTTKKRIFLRRWNSTINKFTTNNHIC*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
