SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma11g30110

Feature Type:gene_model
Chromosome:Gm11
Start:31010917
stop:31013840
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30360AT Annotation by Michelle Graham. TAIR10: SOS3-interacting protein 4 | chr2:12937265-12938572 REVERSE LENGTH=435 SoyBaseE_val: 9.00E-174ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009268GO-bp Annotation by Michelle Graham. GO Biological Process: response to pH SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
KOG0583 KOG Serine/threonine protein kinase JGI ISS
PTHR24343Panther SERINE/THREONINE KINASE JGI ISS
PTHR24343:SF45Panther SERINE/THREONINE-PROTEIN KINASE PTK1,2/STK1,2 JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
PF03822PFAM NAF domain JGI ISS
UniRef100_B9RVE0UniRef Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting serine/threonine-protein kinase, putative n=1 Tax=Ricinus communis RepID=B9RVE0_RICCO SoyBaseE_val: 0ISS
UniRef100_UPI0001CAE45BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001CAE45B related cluster n=1 Tax=unknown RepID=UPI0001CAE45B SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g06130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.13g069500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma11g30110.2   sequence type=CDS   gene model=Glyma11g30110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGGAGATCGGCCAGGCGGCGGTGGCTGCGGCGGCGGATGACACCGCCCTGTTCGGAAAATACGAGCTGGGCCGCATCCTCGGCTGCGGCGCCTTCGCCAAAGTCCACTACGCGCGCAACGTGCAAACGGGGCAGAGCGTGGCCGTGAAAATCATCAACAAAAAAAAACTCGCCGGAACTGGCCTCGCCGGAAACGTGAAGCGCGAAATCACGATCATGAGCAAGCTCCACCACCCCCACATCGTGCGCCTCCACGAGGTCCTCGCCACCAAGACCAAAATCTTCTTCATTATGGACTTCGTACGCGGCGGCGAGCTGTTCGGGAAAATCTCAAAGGGCCGATTCGCCGAGGATCTCAGCCGCAAATACTTTCATCAACTGATCTCCGCCGTGGGGTACTGCCACTCGCGCGGCGTATTCCACCGCGACCTCAAGCCGGAGAATCTCCTCCTCGACGAGAACGGCGATTTGAGGGTCTCGGATTTCGGGTTGAGTGCGGTTCGGGATCAGATCCGACCCGATGGCTTGCTCCACACGCTTTGCGGAACCCCTGCTTACGTGGCACCAGAGATTTTAGGCAAAAAAGGTTATGATGGTGCCAAGGTTGATGTGTGGTCATGCGGCGTCGTTTTGTTCGTGCTCGCCGCAGGTTACTTACCATTCAACGACCCGAATTTGATGGTAATGTATAGGAAAATCTACAAAGGCGAGTTCCGGTGTCCGCGGTGGATGTCGCCGGAGCTCCGGCGATTCATATCGAAGTTGCTCGACACGAACCCAGAAACGAGGATCACGGTGGATGGCATGACGCGGGACCCGTGGTTCAAAAAAGGGTATAAAGAATTGAAATTTCACGAAGAGGATTACCATGCATCCGGGTCGGGTTCGTTTTTCGGGCCGAAGGATGAGAGGGTGGTGAATTTGAACGCTTTTGATTTGATATCTTTTTCTTCGGGGTTGGATTTGTCCGGGATGTTTGGGGGGGAGTGGGGGGAGAGGTTGGTGACGCGGGAGCCGCCGGAGAGGGTTTACCGGCTCACGGCGGAGCTCGCGGTGGTGGAGGTAAGGAAGAGGGGAGGCGACGCCGCGGTGAGGGGTGTGTGGGAGGAGAGGTTGAAGCCATTGTTGCTTGGTGGTGCAACCACGTCGTATAGTAATAGTAGTGAGGATGAACAACAACATCAAGAAGAAGAACAACAACATCAAGAAGAAAAACAGGAACAAGAACCTGAGTCGAAGGTTGCCTGTGAATGA

>Glyma11g30110.2   sequence type=predicted peptide   gene model=Glyma11g30110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPEIGQAAVAAAADDTALFGKYELGRILGCGAFAKVHYARNVQTGQSVAVKIINKKKLAGTGLAGNVKREITIMSKLHHPHIVRLHEVLATKTKIFFIMDFVRGGELFGKISKGRFAEDLSRKYFHQLISAVGYCHSRGVFHRDLKPENLLLDENGDLRVSDFGLSAVRDQIRPDGLLHTLCGTPAYVAPEILGKKGYDGAKVDVWSCGVVLFVLAAGYLPFNDPNLMVMYRKIYKGEFRCPRWMSPELRRFISKLLDTNPETRITVDGMTRDPWFKKGYKELKFHEEDYHASGSGSFFGPKDERVVNLNAFDLISFSSGLDLSGMFGGEWGERLVTREPPERVYRLTAELAVVEVRKRGGDAAVRGVWEERLKPLLLGGATTSYSNSSEDEQQHQEEEQQHQEEKQEQEPESKVACE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo