SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma11g30000

Feature Type:gene_model
Chromosome:Gm11
Start:30902976
stop:30903065
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma11g30000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32050AT Annotation by Michelle Graham. TAIR10: SCAMP family protein | chr1:11528616-11530974 FORWARD LENGTH=264 SoyBaseE_val: 2.00E-13ISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
PF04144PFAM SCAMP family JGI ISS
UniRef100_B9DI68UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT1G32050 protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B9DI68_ARATH SoyBaseE_val: 5.00E-13ISS
UniRef100_UPI000233C686UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C686 related cluster n=1 Tax=unknown RepID=UPI000233C686 SoyBaseE_val: 3.00E-13ISS

Expression Patterns of Glyma11g30000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma11g30000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma11g30000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma11g30000
>Glyma11g30000.1   sequence type=CDS   gene model=Glyma11g30000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGTTCCTATTGATGATAAGAATTGGCCTCCATTTTTCCCAATCATTCACCATGATATTGCCAATGAGATACCAGTTCATGCTCAGAGG
Predicted protein sequences of Glyma11g30000
>Glyma11g30000.1   sequence type=predicted peptide   gene model=Glyma11g30000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GVPIDDKNWPPFFPIIHHDIANEIPVHAQR






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo