|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G32050 | AT | Annotation by Michelle Graham. TAIR10: SCAMP family protein | chr1:11528616-11530974 FORWARD LENGTH=264 | SoyBase | E_val: 2.00E-13 | ISS |
| GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
| GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0022857 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity | SoyBase | N/A | ISS |
| PF04144 | PFAM | SCAMP family | JGI | ISS | |
| UniRef100_B9DI68 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AT1G32050 protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=B9DI68_ARATH | SoyBase | E_val: 5.00E-13 | ISS |
| UniRef100_UPI000233C686 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C686 related cluster n=1 Tax=unknown RepID=UPI000233C686 | SoyBase | E_val: 3.00E-13 | ISS |
|
Glyma11g30000 not represented in the dataset |
Glyma11g30000 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma11g30000.1 sequence type=CDS gene model=Glyma11g30000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GGTGTTCCTATTGATGATAAGAATTGGCCTCCATTTTTCCCAATCATTCACCATGATATTGCCAATGAGATACCAGTTCATGCTCAGAGG
>Glyma11g30000.1 sequence type=predicted peptide gene model=Glyma11g30000 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GVPIDDKNWPPFFPIIHHDIANEIPVHAQR
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||